DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17760 and gna11b

DIOPT Version :9

Sequence 1:NP_001036539.1 Gene:CG17760 / 36385 FlyBaseID:FBgn0033756 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001007774.1 Gene:gna11b / 493613 ZFINID:ZDB-GENE-041121-9 Length:359 Species:Danio rerio


Alignment Length:353 Identity:220/353 - (62%)
Similarity:284/353 - (80%) Gaps:0/353 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDCCLSDQACEERRISREIDKFLKAEKKKARRELKLLVLGTGESGKTTFIKQMRIIHGKGFLDKE 65
            |.||||::|.|.:||:.||||.|:.:|:.||||||||:||||||||:|||||||||||.|:.|::
Zfish     7 MACCLSEEAKESKRINAEIDKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGAGYTDED 71

  Fly    66 RKQFTKNVFQNIFMAIQSMISAMDTLRIPYGQQEHSKLADLVKSIDYKTVTRLEAPYLNAIKTLW 130
            ::.|||.|:||||.::|:||.|.:||:|.|..:::...|.|||.:|.:.|...:.||:||:|.||
Zfish    72 KRGFTKLVYQNIFTSMQAMIRATETLKIGYKYEQNKANAMLVKEVDIEKVMSFDHPYINAVKMLW 136

  Fly   131 KDAGIKECYNRRREYQLTDSTEYFLNDIARIERSDYQATDQDILHVRAPTTNIVEYPFNLDGFLI 195
            .|.||:|.|:|||||||:|||:|:|:|:.||..|.|..|.||:|.||.|||.|:||||:|...:.
Zfish   137 SDPGIQEAYDRRREYQLSDSTKYYLSDLDRIAESSYLPTQQDVLRVRIPTTGIIEYPFDLQSIIF 201

  Fly   196 RLVDVAGQRTERRKWIHCFSNVTSIMFLVAMSEFDLSLAESENDNRMKESKALFHNIISFSWFQH 260
            |:|||.|||:|||||||||.||||||||||:||:|..|.||:|:|||:||||||..||::.|||:
Zfish   202 RMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQN 266

  Fly   261 SSVILFLNKEDLFKKKILSTHLADYFPEYNGPKKDAKAAREFILYMFTSVNPDPYKCIYPHFTVA 325
            |||||||||:||.::||..:||.|||||::||::||:|||||||.||..:|||..|.||.|||.|
Zfish   267 SSVILFLNKKDLLEEKISYSHLVDYFPEFDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCA 331

  Fly   326 TNTENIKFVFTAVKDTILELHLSETNLL 353
            |:||||:|||.|||||||:|:|.|.||:
Zfish   332 TDTENIRFVFAAVKDTILQLNLKEYNLV 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17760NP_001036539.1 G_alpha 13..351 CDD:214595 211/337 (63%)
G-alpha 34..347 CDD:206639 197/312 (63%)
gna11bNP_001007774.1 G_alpha 19..357 CDD:214595 211/337 (63%)
G-alpha 40..353 CDD:206639 197/312 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 1 1.010 - - D373878at33208
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.790

Return to query results.
Submit another query.