DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17760 and gnas

DIOPT Version :9

Sequence 1:NP_001036539.1 Gene:CG17760 / 36385 FlyBaseID:FBgn0033756 Length:353 Species:Drosophila melanogaster
Sequence 2:XP_031750701.1 Gene:gnas / 407931 XenbaseID:XB-GENE-947774 Length:412 Species:Xenopus tropicalis


Alignment Length:358 Identity:141/358 - (39%)
Similarity:209/358 - (58%) Gaps:21/358 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SREIDKFLKAEKKKARRELKLLVLGTGESGKTTFIKQMRIIHGKGFLDKERKQFTKNVFQNIFMA 80
            ||.|||.|||||::.::..:||:||.|||||:|.:|||||:|..||..:|:|...:::..||..|
 Frog    56 SRSIDKTLKAEKREYKQIHRLLLLGAGESGKSTIVKQMRILHVNGFNAEEKKIKVQDIKNNIKEA 120

  Fly    81 IQSMISAMDTLRIP--YGQQEHSKLADLVKSIDYKTVTRLEAPYLNAIKTLWKDAGIKECYNRRR 143
            |:::::||..|..|  ....|:....|.:.::...........:....||||:|.|::.||.|..
 Frog   121 IETIVTAMCNLSPPVELANPENQFRIDYILNLPSHKDFDFSPEFYEHTKTLWQDEGVRLCYERSN 185

  Fly   144 EYQLTDSTEYFLNDIARIERSDYQATDQDILHVRAPTTNIVEYPFNLDGFLIRLVDVAGQRTERR 208
            ||||.|..:|||:.|..::::||..||||:|..|..|:.|.|..|.:|.....:.||.|||.|||
 Frog   186 EYQLIDCAQYFLDKIDIVKQNDYTPTDQDLLRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERR 250

  Fly   209 KWIHCFSNVTSIMFLVAMSEFDLSLAESENDNRMKESKALFHNIISFSWFQHSSVILFLNKEDLF 273
            |||.||::||:|:|:||.|.:::.:.|..:.||::|:..||.:|.:..|.:..||||||||:||.
 Frog   251 KWIQCFNDVTAIIFVVASSSYNMVIREDNHTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDLL 315

  Fly   274 --KKKILSTHLADYFPEY------------NGPKKDAKAAREFI----LYMFTSVNPDPYKCIYP 320
              |.|:..:.:.|||||:            .|.:.....|:.||    |.:.|:.....:.| ||
 Frog   316 AEKVKVGKSKIEDYFPEFARYTTPDDATPEPGEEPQVTRAKYFIRDEFLRISTASGDGRHYC-YP 379

  Fly   321 HFTVATNTENIKFVFTAVKDTILELHLSETNLL 353
            |||.|.:||||:.||...:|.|..:||.:..||
 Frog   380 HFTCAVDTENIRRVFNDCRDIIQRMHLRQYELL 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17760NP_001036539.1 G_alpha 13..351 CDD:214595 139/354 (39%)
G-alpha 34..347 CDD:206639 127/332 (38%)
gnasXP_031750701.1 G-alpha 74..406 CDD:206639 127/332 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.