DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17760 and gnai2

DIOPT Version :9

Sequence 1:NP_001036539.1 Gene:CG17760 / 36385 FlyBaseID:FBgn0033756 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_989250.1 Gene:gnai2 / 394861 XenbaseID:XB-GENE-6050844 Length:355 Species:Xenopus tropicalis


Alignment Length:360 Identity:164/360 - (45%)
Similarity:226/360 - (62%) Gaps:14/360 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDCCLS--DQACEERRISREIDKFLKAEKKKARRELKLLVLGTGESGKTTFIKQMRIIHGKGFLD 63
            |.|.:|  |:|..||  |:.|||.|:.:.:||.||:|||:||.|||||:|.:|||:|||..|:.:
 Frog     1 MGCTVSAEDKAAAER--SKNIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDGYSE 63

  Fly    64 KERKQFTKNVFQNIFMAIQSMISAMDTLRIPYGQQEHSKLADLVKSIDYKTVTRLEAPYL----- 123
            :|.:|:...||.|...:|.::|.||..|:|.:|....   ||..:.:...:.|..|...|     
 Frog    64 EECRQYRAVVFSNTIQSIMAIIKAMGNLKIDFGDPAR---ADDARQLFALSSTAEEQGILPDDLA 125

  Fly   124 NAIKTLWKDAGIKECYNRRREYQLTDSTEYFLNDIARIERSDYQATDQDILHVRAPTTNIVEYPF 188
            ..|:.||.|.|::.|::|.|||||.||..|:|||:.||.||||..|.||:|..|..||.|||..|
 Frog   126 GVIRRLWADPGVQACFSRSREYQLNDSAAYYLNDLERIARSDYVPTQQDVLRTRVKTTGIVETHF 190

  Fly   189 NLDGFLIRLVDVAGQRTERRKWIHCFSNVTSIMFLVAMSEFDLSLAESENDNRMKESKALFHNII 253
            .......::.||.|||:||:||||||..||:|:|.||:|.:||.|||.|..|||.||..||.:|.
 Frog   191 TFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEEMNRMHESMKLFDSIC 255

  Fly   254 SFSWFQHSSVILFLNKEDLFKKKILSTHLADYFPEYNGPKKDAKAAREFILYMFTSVNP-DPYKC 317
            :..||..:|:||||||:|||::||..:.|:..||||:|..:..:|| .:|...|..:|. ...|.
 Frog   256 NNKWFTETSIILFLNKKDLFEEKITRSPLSICFPEYSGANQYDEAA-SYIQTKFEDLNKRRDTKE 319

  Fly   318 IYPHFTVATNTENIKFVFTAVKDTILELHLSETNL 352
            ||.|||.||:|:|::|||.||.|.|::.:|.:..|
 Frog   320 IYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGL 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17760NP_001036539.1 G_alpha 13..351 CDD:214595 157/343 (46%)
G-alpha 34..347 CDD:206639 146/318 (46%)
gnai2NP_989250.1 G-alpha 34..349 CDD:206639 146/318 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.