DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17760 and gnai1

DIOPT Version :9

Sequence 1:NP_001036539.1 Gene:CG17760 / 36385 FlyBaseID:FBgn0033756 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_957265.1 Gene:gnai1 / 393946 ZFINID:ZDB-GENE-040426-1310 Length:354 Species:Danio rerio


Alignment Length:359 Identity:162/359 - (45%)
Similarity:225/359 - (62%) Gaps:13/359 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDCCLS--DQACEERRISREIDKFLKAEKKKARRELKLLVLGTGESGKTTFIKQMRIIHGKGFLD 63
            |.|.||  |:|..||  |:.||:.|:.:.:||.||:|||:||.|||||:|.:|||:|||..|:.:
Zfish     1 MGCTLSTEDKAAVER--SKMIDRNLRDDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSE 63

  Fly    64 KERKQFTKNVFQNIFMAIQSMISAMDTLRIPYGQ----QEHSKLADLVKSIDYKTVTRLEAPYLN 124
            :|.||:...|:.|...:|.::|.||..|:|.:|.    .:..:|..|..|.:...:|   |....
Zfish    64 EECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDAARADDARQLFVLAGSAEEGFMT---AELAG 125

  Fly   125 AIKTLWKDAGIKECYNRRREYQLTDSTEYFLNDIARIERSDYQATDQDILHVRAPTTNIVEYPFN 189
            .||.||||.|::.|::|.|||||.||..|:|||:.||.::.|..|.||:|..|..||.|||..|.
Zfish   126 VIKRLWKDGGVQACFSRSREYQLNDSAAYYLNDLDRISQATYIPTQQDVLRTRVKTTGIVETHFT 190

  Fly   190 LDGFLIRLVDVAGQRTERRKWIHCFSNVTSIMFLVAMSEFDLSLAESENDNRMKESKALFHNIIS 254
            ......::.||.|||:||:||||||..||:|:|.||:|::||.|||.|..|||.||..||.:|.:
Zfish   191 FKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICN 255

  Fly   255 FSWFQHSSVILFLNKEDLFKKKILSTHLADYFPEYNGPKKDAKAAREFILYMFTSVNP-DPYKCI 318
            ..||..:|:||||||:|||::||..:.|...:|||.|.....:|| .:|...|..:|. ...|.|
Zfish   256 NKWFTDTSIILFLNKKDLFEEKIRKSTLTICYPEYAGSNTYEEAA-AYIQCQFEDLNKRKDTKEI 319

  Fly   319 YPHFTVATNTENIKFVFTAVKDTILELHLSETNL 352
            |.|||.||:|:|::|||.||.|.|::.:|.:..|
Zfish   320 YTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGL 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17760NP_001036539.1 G_alpha 13..351 CDD:214595 154/342 (45%)
G-alpha 34..347 CDD:206639 144/317 (45%)
gnai1NP_957265.1 G_alpha 14..352 CDD:214595 155/343 (45%)
G-alpha 34..348 CDD:206639 144/317 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.