DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17760 and Gnat2

DIOPT Version :9

Sequence 1:NP_001036539.1 Gene:CG17760 / 36385 FlyBaseID:FBgn0033756 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001102420.2 Gene:Gnat2 / 365901 RGDID:1309514 Length:354 Species:Rattus norvegicus


Alignment Length:353 Identity:143/353 - (40%)
Similarity:216/353 - (61%) Gaps:9/353 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LSDQACEERRISREIDKFLKAEKKKARRELKLLVLGTGESGKTTFIKQMRIIHGKGFLDKERKQF 69
            :|.:..|..:.|||::|.|:.:..|..:.:|||:||.|||||:|.:|||:|||..|:..:|..:|
  Rat     5 ISAEDKELAKRSRELEKKLQEDADKEAKTVKLLLLGAGESGKSTIVKQMKIIHQDGYSPEECLEF 69

  Fly    70 TKNVFQNIFMAIQSMISAMDTLRIPYGQ----QEHSKLADLVKSIDYKTVTRLEAPYLNAIKTLW 130
            ...::.|:..:|.::|.||.||.|.|.:    :...:|.:|..|.:..|   :.:..:..|:.||
  Rat    70 KSVIYGNVLQSILAIIRAMSTLGIDYAEPSCAEAGRQLNNLADSTEEGT---MPSELVEVIRKLW 131

  Fly   131 KDAGIKECYNRRREYQLTDSTEYFLNDIARIERSDYQATDQDILHVRAPTTNIVEYPFNLDGFLI 195
            ||.|::.|::|..|:||.||..|:||.:.||...||...:||:|..|..||.|:|..|::.....
  Rat   132 KDGGVQACFDRAAEFQLNDSASYYLNQLDRITDPDYLPNEQDVLRSRVKTTGIIETKFSVKDLNF 196

  Fly   196 RLVDVAGQRTERRKWIHCFSNVTSIMFLVAMSEFDLSLAESENDNRMKESKALFHNIISFSWFQH 260
            |:.||.|||:||:||||||..||.|:|..|:|.:|:.|.|.:..|||.||..||::|.:..:|..
  Rat   197 RMFDVGGQRSERKKWIHCFEGVTCIIFCAALSAYDMVLVEDDEVNRMHESLHLFNSICNHKFFAA 261

  Fly   261 SSVILFLNKEDLFKKKILSTHLADYFPEYNGPKKDAKAAREFILYMFTSVN-PDPYKCIYPHFTV 324
            :|::|||||:|||::||...||:..||||:| ....:.|..:|...|..:| ....|.||.|.|.
  Rat   262 TSIVLFLNKKDLFEEKIKKVHLSICFPEYDG-NNSYEDAGNYIKSQFLDLNMRKDVKEIYSHMTC 325

  Fly   325 ATNTENIKFVFTAVKDTILELHLSETNL 352
            ||:|:|:||||.||.|.|::.:|.:..|
  Rat   326 ATDTQNVKFVFDAVTDIIIKENLKDCGL 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17760NP_001036539.1 G_alpha 13..351 CDD:214595 140/342 (41%)
G-alpha 34..347 CDD:206639 133/317 (42%)
Gnat2NP_001102420.2 G-alpha 34..348 CDD:206639 133/317 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X53
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.