DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17760 and gna13b

DIOPT Version :9

Sequence 1:NP_001036539.1 Gene:CG17760 / 36385 FlyBaseID:FBgn0033756 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001013281.2 Gene:gna13b / 336333 ZFINID:ZDB-GENE-030131-8277 Length:377 Species:Danio rerio


Alignment Length:360 Identity:147/360 - (40%)
Similarity:218/360 - (60%) Gaps:9/360 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DCCLSDQACEERRISREIDKFLKAEKKKARRELKLLVLGTGESGKTTFIKQMRIIHGKGFLDKER 66
            :|.|.....|:.|.|:|||:.:..||...:|.:|:|:||.|||||:||:||||||||..|...::
Zfish    17 NCFLDSSDAEQLRKSKEIDREIFKEKTFVKRLVKILLLGAGESGKSTFLKQMRIIHGDDFDKGDK 81

  Fly    67 KQFTKNVFQNIFMAIQSMISAMDTLRIPYGQQEHSKLADLVKSIDYKTV--------TRLEAPYL 123
            ::|...::.|:...::.::.|.:.|.||:|...:...||::.:.|.::.        |:|...||
Zfish    82 EEFRGTIYSNVMKGVRVLVDAREKLHIPWGNPSNQTHADIMMAFDTRSTMVSQGMLETKLFPQYL 146

  Fly   124 NAIKTLWKDAGIKECYNRRREYQLTDSTEYFLNDIARIERSDYQATDQDILHVRAPTTNIVEYPF 188
            .:|:.||.|.||:..|:||||:||.:|.:|||:::.::...||..|.||||..|.||..|.||.|
Zfish   147 PSIRALWADIGIQHAYDRRREFQLGESVKYFLDNLDKLGAPDYLPTQQDILLARKPTKGIHEYDF 211

  Fly   189 NLDGFLIRLVDVAGQRTERRKWIHCFSNVTSIMFLVAMSEFDLSLAESENDNRMKESKALFHNII 253
            .:.....::|||.|||:|||:|..||.:||||:|||:.||:|..|.|....||:.||..:|..|:
Zfish   212 EIKNVPFKMVDVGGQRSERRRWFECFESVTSILFLVSSSEYDQVLMEDRQTNRLMESLNIFETIV 276

  Fly   254 SFSWFQHSSVILFLNKEDLFKKKILSTHLADYFPEYNGPKKDAKAAREFILYMFTSVNPD-PYKC 317
            :...|.:.|:||||||.||.::|:.|..:.|||||:..........:.|::..|.:...| ..|.
Zfish   277 NNRVFNNVSIILFLNKTDLLEEKVKSVSIQDYFPEFTDDPWCLGDVKNFLVECFRNKRRDQQQKP 341

  Fly   318 IYPHFTVATNTENIKFVFTAVKDTILELHLSETNL 352
            :|.|||.|.|||||:.||..||||||..:|.:..|
Zfish   342 LYHHFTTAINTENIRLVFRDVKDTILHDNLKQLML 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17760NP_001036539.1 G_alpha 13..351 CDD:214595 143/346 (41%)
G-alpha 34..347 CDD:206639 134/321 (42%)
gna13bNP_001013281.2 G_alpha 29..375 CDD:214595 143/345 (41%)
G-alpha 49..371 CDD:206639 134/321 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586255
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.760

Return to query results.
Submit another query.