DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17760 and cta

DIOPT Version :9

Sequence 1:NP_001036539.1 Gene:CG17760 / 36385 FlyBaseID:FBgn0033756 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001036421.1 Gene:cta / 3355131 FlyBaseID:FBgn0000384 Length:457 Species:Drosophila melanogaster


Alignment Length:365 Identity:151/365 - (41%)
Similarity:216/365 - (59%) Gaps:22/365 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CC-----------LSDQACEERRISREIDKFLKAEKKKARRELKLLVLGTGESGKTTFIKQMRII 56
            ||           .:.:..|:|..|:||||||:.||...||::|||:||.|||||:||:||||||
  Fly    91 CCGNIITYLVRLRSTPEELEQRYKSKEIDKFLEKEKHTFRRQVKLLLLGAGESGKSTFLKQMRII 155

  Fly    57 HGKGFLDKERKQFTKNVFQNIFMAIQSMISAMDTLRIPYGQQEHSKLADLVKSIDYKTVTRLEAP 121
            ||..|..:...::...::||:...:|.::.|.:.|.|.:|.....:.|...|.::..:   |:.|
  Fly   156 HGVNFDYELLLEYQSVIYQNVIRGMQVLLDAREKLNIAWGSDGREQDAYDAKLMECNS---LDVP 217

  Fly   122 ----YLNAIKTLWKDAGIKECYNRRREYQLTDSTEYFLNDIARIERSDYQATDQDILHVRAPTTN 182
                |...|..||:|.||:..:.||||:|::||..|||::|.|:...||..|.:||||.|..|..
  Fly   218 KFMEYAPPISRLWQDRGIRRAFERRREFQISDSVSYFLDEIQRLATPDYVPTHKDILHCRKATKG 282

  Fly   183 IVEYPFNLDGFLIRLVDVAGQRTERRKWIHCF-SNVTSIMFLVAMSEFDLSLAESENDNRMKESK 246
            :.|:...:.......|||.||||:|:||..|| |:||||:|||:.||||..|||....||::|||
  Fly   283 VYEFCVKVQNIPFVFVDVGGQRTQRQKWTRCFDSSVTSIIFLVSSSEFDQVLAEDRKTNRLEESK 347

  Fly   247 ALFHNIISFSWFQHSSVILFLNKEDLFKKKILS--THLADYFPEYNGPKKDAKAAREFILYMFTS 309
            .:|..|::.:.|:..|:||||||.||.::|:.:  |.:..|:|.:||........:.|||.||.|
  Fly   348 NIFDTIVNNATFKGISIILFLNKTDLLEQKVCNPETDIRWYYPHFNGNPHSVLDVQNFILQMFMS 412

  Fly   310 V-NPDPYKCIYPHFTVATNTENIKFVFTAVKDTILELHLS 348
            | .......||.|||.|.:|.||..||.:||||||:.:|:
  Fly   413 VRRSSSISRIYHHFTTAIDTRNINVVFNSVKDTILQRNLN 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17760NP_001036539.1 G_alpha 13..351 CDD:214595 148/344 (43%)
G-alpha 34..347 CDD:206639 135/320 (42%)
ctaNP_001036421.1 G_alpha 112..455 CDD:214595 148/344 (43%)
G-alpha 133..451 CDD:206639 135/320 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455795
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D63213at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10218
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
65.850

Return to query results.
Submit another query.