DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17760 and GNAO1

DIOPT Version :9

Sequence 1:NP_001036539.1 Gene:CG17760 / 36385 FlyBaseID:FBgn0033756 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_066268.1 Gene:GNAO1 / 2775 HGNCID:4389 Length:354 Species:Homo sapiens


Alignment Length:357 Identity:167/357 - (46%)
Similarity:225/357 - (63%) Gaps:19/357 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDCCLS--DQACEERRISREIDKFLKAEKKKARRELKLLVLGTGESGKTTFIKQMRIIHGKGFLD 63
            |.|.||  ::|..||  |:.|:|.||.:...|.:::|||:||.|||||:|.:|||:|||..||..
Human     1 MGCTLSAEERAALER--SKAIEKNLKEDGISAAKDVKLLLLGAGESGKSTIVKQMKIIHEDGFSG 63

  Fly    64 KERKQFTKNVFQNIFMAIQSMISAMDTLRIPYGQQEHSKLADLVKSIDYKTVTRLE------APY 122
            ::.||:...|:.|...::.:::.|||||.|.||.:|....|.:|..:    |:|:|      |..
Human    64 EDVKQYKPVVYSNTIQSLAAIVRAMDTLGIEYGDKERKADAKMVCDV----VSRMEDTEPFSAEL 124

  Fly   123 LNAIKTLWKDAGIKECYNRRREYQLTDSTEYFLNDIARIERSDYQATDQDILHVRAPTTNIVEYP 187
            |:|:..||.|:||:||:||.|||||.||.:|:|:.:.||..:|||.|:||||..|..||.|||..
Human   125 LSAMMRLWGDSGIQECFNRSREYQLNDSAKYYLDSLDRIGAADYQPTEQDILRTRVKTTGIVETH 189

  Fly   188 FNLDGFLIRLVDVAGQRTERRKWIHCFSNVTSIMFLVAMSEFDLSLAESENDNRMKESKALFHNI 252
            |.......||.||.|||:||:||||||.:||:|:|.||:|.:|..|.|.|..|||.||..||.:|
Human   190 FTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDETTNRMHESLMLFDSI 254

  Fly   253 ISFSWFQHSSVILFLNKEDLFKKKILSTHLADYFPEYNGPK--KDAKAAREFILYMFTSVNPDPY 315
            .:..:|..:|:||||||:|||.:||..:.|...||||.||.  :||.|   :|...|.|.|..|.
Human   255 CNNKFFIDTSIILFLNKKDLFGEKIKKSPLTICFPEYTGPNTYEDAAA---YIQAQFESKNRSPN 316

  Fly   316 KCIYPHFTVATNTENIKFVFTAVKDTILELHL 347
            |.||.|.|.||:|.||:.||.||.|.|:..:|
Human   317 KEIYCHMTCATDTNNIQVVFDAVTDIIIANNL 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17760NP_001036539.1 G_alpha 13..351 CDD:214595 161/343 (47%)
G-alpha 34..347 CDD:206639 153/320 (48%)
GNAO1NP_066268.1 G-alpha 34..348 CDD:206639 153/320 (48%)
G1 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 35..48 10/12 (83%)
G2 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 174..182 4/7 (57%)
G3 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 197..206 5/8 (63%)
G4 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 266..273 6/6 (100%)
G5 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 324..329 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.