DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17760 and GNAL

DIOPT Version :9

Sequence 1:NP_001036539.1 Gene:CG17760 / 36385 FlyBaseID:FBgn0033756 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_892023.1 Gene:GNAL / 2774 HGNCID:4388 Length:458 Species:Homo sapiens


Alignment Length:363 Identity:142/363 - (39%)
Similarity:214/363 - (58%) Gaps:21/363 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 EERRISREIDKFLKAEKKKARRELKLLVLGTGESGKTTFIKQMRIIHGKGFLDKERKQFTKNVFQ 75
            |.|::||.||:.|:.:|:..::..:||:||.|||||:|.:|||||:|..||..:|:||...::.:
Human    97 EARKVSRGIDRMLRDQKRDLQQTHRLLLLGAGESGKSTIVKQMRILHVNGFNPEEKKQKILDIRK 161

  Fly    76 NIFMAIQSMISAMDTL--RIPYGQQEHSKLADLVKSIDYKTVTRLEAPYLNAIKTLWKDAGIKEC 138
            |:..||.:::|||.|:  .:|....|:...:|.:|||...|.......:.:.:|.||.|.|:|.|
Human   162 NVKDAIVTIVSAMSTIIPPVPLANPENQFRSDYIKSIAPITDFEYSQEFFDHVKKLWDDEGVKAC 226

  Fly   139 YNRRREYQLTDSTEYFLNDIARIERSDYQATDQDILHVRAPTTNIVEYPFNLDGFLIRLVDVAGQ 203
            :.|..||||.|..:|||..|..:...||..||||:|..|..|:.|.|..|.:|.....:.||.||
Human   227 FERSNEYQLIDCAQYFLERIDSVSLVDYTPTDQDLLRCRVLTSGIFETRFQVDKVNFHMFDVGGQ 291

  Fly   204 RTERRKWIHCFSNVTSIMFLVAMSEFDLSLAESENDNRMKESKALFHNIISFSWFQHSSVILFLN 268
            |.||||||.||::||:|:::.|.|.:::.:.|..|.||::||..||.:|.:..|.:..|:|||||
Human   292 RDERRKWIQCFNDVTAIIYVAACSSYNMVIREDNNTNRLRESLDLFESIWNNRWLRTISIILFLN 356

  Fly   269 KEDLFKKKILS--THLADYFPEYNG---PK-------KDAKAA------REFILYMFTSVNPDPY 315
            |:|:..:|:|:  :.:.||||||..   |:       :|.|..      |:..|.:.|:.....:
Human   357 KQDMLAEKVLAGKSKIEDYFPEYANYTVPEDATPDAGEDPKVTRAKFFIRDLFLRISTATGDGKH 421

  Fly   316 KCIYPHFTVATNTENIKFVFTAVKDTILELHLSETNLL 353
            .| |||||.|.:||||:.||...:|.|..:||.:..||
Human   422 YC-YPHFTCAVDTENIRRVFNDCRDIIQRMHLKQYELL 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17760NP_001036539.1 G_alpha 13..351 CDD:214595 139/357 (39%)
G-alpha 34..347 CDD:206639 130/332 (39%)
GNALNP_892023.1 G_alpha 99..455 CDD:214595 139/356 (39%)
G-alpha 120..452 CDD:206639 130/332 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151718
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.