DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17760 and Gnai1

DIOPT Version :9

Sequence 1:NP_001036539.1 Gene:CG17760 / 36385 FlyBaseID:FBgn0033756 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_037277.1 Gene:Gnai1 / 25686 RGDID:2713 Length:354 Species:Rattus norvegicus


Alignment Length:364 Identity:163/364 - (44%)
Similarity:228/364 - (62%) Gaps:23/364 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDCCLS--DQACEERRISREIDKFLKAEKKKARRELKLLVLGTGESGKTTFIKQMRIIHGKGFLD 63
            |.|.||  |:|..||  |:.||:.|:.:.:||.||:|||:||.|||||:|.:|||:|||..|:.:
  Rat     1 MGCTLSAEDKAAVER--SKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSE 63

  Fly    64 KERKQFTKNVFQNIFMAIQSMISAMDTLRIPYGQQEHSKLADLVKSIDYKTVTRL----EAPYLN 124
            :|.||:...|:.|...:|.::|.||..|:|.:|        |..::.|.:.:..|    |..::.
  Rat    64 EECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFG--------DAARADDARQLFVLAGAAEEGFMT 120

  Fly   125 A-----IKTLWKDAGIKECYNRRREYQLTDSTEYFLNDIARIERSDYQATDQDILHVRAPTTNIV 184
            |     ||.||||:|::.|:||.|||||.||..|:|||:.||.:.:|..|.||:|..|..||.||
  Rat   121 AELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIV 185

  Fly   185 EYPFNLDGFLIRLVDVAGQRTERRKWIHCFSNVTSIMFLVAMSEFDLSLAESENDNRMKESKALF 249
            |..|.......::.||.|||:||:||||||..||:|:|.||:|::||.|||.|..|||.||..||
  Rat   186 ETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLF 250

  Fly   250 HNIISFSWFQHSSVILFLNKEDLFKKKILSTHLADYFPEYNGPKKDAKAAREFILYMFTSVNP-D 313
            .:|.:..||..:|:||||||:|||::||..:.|...:|||.|.....:|| .:|...|..:|. .
  Rat   251 DSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAA-AYIQCQFEDLNKRK 314

  Fly   314 PYKCIYPHFTVATNTENIKFVFTAVKDTILELHLSETNL 352
            ..|.||.|||.||:|:|::|||.||.|.|::.:|.:..|
  Rat   315 DTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGL 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17760NP_001036539.1 G_alpha 13..351 CDD:214595 155/347 (45%)
G-alpha 34..347 CDD:206639 145/322 (45%)
Gnai1NP_037277.1 G-alpha 34..348 CDD:206639 145/322 (45%)
G1 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 35..48 10/12 (83%)
G2 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 173..181 3/7 (43%)
G3 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 196..205 3/8 (38%)
G4 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 265..272 6/6 (100%)
G5 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 324..329 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X53
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.