DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17760 and CG30054

DIOPT Version :9

Sequence 1:NP_001036539.1 Gene:CG17760 / 36385 FlyBaseID:FBgn0033756 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001036538.3 Gene:CG30054 / 246420 FlyBaseID:FBgn0050054 Length:353 Species:Drosophila melanogaster


Alignment Length:352 Identity:241/352 - (68%)
Similarity:295/352 - (83%) Gaps:0/352 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDCCLSDQACEERRISREIDKFLKAEKKKARRELKLLVLGTGESGKTTFIKQMRIIHGKGFLDKE 65
            |.||.|.:|.|:|||:.||||.|:.|||:::||||||:||..||||:|||||||||||.|:.|::
  Fly     1 MHCCSSTEAMEKRRINEEIDKQLRLEKKRSKRELKLLLLGACESGKSTFIKQMRIIHGSGYSDED 65

  Fly    66 RKQFTKNVFQNIFMAIQSMISAMDTLRIPYGQQEHSKLADLVKSIDYKTVTRLEAPYLNAIKTLW 130
            ::.:.|.||||||||:||||.|||.|:|.|||.|||:|||||.||||:|||..|.||||||||||
  Fly    66 KRGYIKLVFQNIFMAMQSMIKAMDMLKISYGQGEHSELADLVMSIDYETVTTFEDPYLNAIKTLW 130

  Fly   131 KDAGIKECYNRRREYQLTDSTEYFLNDIARIERSDYQATDQDILHVRAPTTNIVEYPFNLDGFLI 195
            .||||:|||:|||||||||||||||.||.|||::||..|:||||..|.||.||..|||.|||:::
  Fly   131 HDAGIQECYDRRREYQLTDSTEYFLGDIGRIEQADYLPTNQDILRAREPTFNITVYPFELDGYVL 195

  Fly   196 RLVDVAGQRTERRKWIHCFSNVTSIMFLVAMSEFDLSLAESENDNRMKESKALFHNIISFSWFQH 260
            .:|||||||||||||||.|||||||:||.|:||:|..:.|||||||::|||||||.||:|.||::
  Fly   196 SMVDVAGQRTERRKWIHFFSNVTSIIFLAALSEYDQFMMESENDNRLEESKALFHTIITFEWFKN 260

  Fly   261 SSVILFLNKEDLFKKKILSTHLADYFPEYNGPKKDAKAAREFILYMFTSVNPDPYKCIYPHFTVA 325
            :|:||||||.|:.::||:.:||.||||||:|||:||.||||::|.||.|::.|.||.||.|||.|
  Fly   261 ASIILFLNKMDVLEEKIMYSHLVDYFPEYDGPKQDAYAAREYVLRMFQSISLDTYKKIYSHFTCA 325

  Fly   326 TNTENIKFVFTAVKDTILELHLSETNL 352
            |:||||||||.|||||||:.:|.|:||
  Fly   326 TDTENIKFVFAAVKDTILQCNLKESNL 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17760NP_001036539.1 G_alpha 13..351 CDD:214595 233/337 (69%)
G-alpha 34..347 CDD:206639 218/312 (70%)
CG30054NP_001036538.3 G_alpha 13..351 CDD:214595 233/337 (69%)
G-alpha 34..347 CDD:206639 218/312 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448996
Domainoid 1 1.000 229 1.000 Domainoid score I660
eggNOG 1 0.900 - - E1_KOG0082
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 233 1.000 Inparanoid score I1124
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D373878at33208
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 1 1.000 - - otm3584
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10218
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
98.990

Return to query results.
Submit another query.