DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17760 and gpa-9

DIOPT Version :9

Sequence 1:NP_001036539.1 Gene:CG17760 / 36385 FlyBaseID:FBgn0033756 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001256444.1 Gene:gpa-9 / 191659 WormBaseID:WBGene00001671 Length:96 Species:Caenorhabditis elegans


Alignment Length:91 Identity:36/91 - (39%)
Similarity:54/91 - (59%) Gaps:1/91 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 WFQHSSVILFLNKEDLFKKKILSTHLADYFPEYNGPKKDAKAAREFILYMFTSVNPDPYKCIYPH 321
            :|..:::||||||.|||:.||..|::...||:|.|| ::...|.|:|...|.|:|.:..:.||.|
 Worm     2 YFHSTAIILFLNKIDLFEIKITHTNITVAFPDYEGP-RERDCALEYIRVQFISLNNNKNRKIYQH 65

  Fly   322 FTVATNTENIKFVFTAVKDTILELHL 347
            .|.||:|..|:.|...:.|.|:...|
 Worm    66 VTSATDTARIQVVIDMLFDIIISASL 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17760NP_001036539.1 G_alpha 13..351 CDD:214595 36/91 (40%)
G-alpha 34..347 CDD:206639 35/89 (39%)
gpa-9NP_001256444.1 P-loop_NTPase <2..91 CDD:304359 35/89 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162138
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.