DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17760 and gpa-6

DIOPT Version :9

Sequence 1:NP_001036539.1 Gene:CG17760 / 36385 FlyBaseID:FBgn0033756 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_510189.1 Gene:gpa-6 / 181442 WormBaseID:WBGene00001668 Length:364 Species:Caenorhabditis elegans


Alignment Length:343 Identity:118/343 - (34%)
Similarity:187/343 - (54%) Gaps:10/343 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SREIDKFLKAEKKKARRELKLLVLGTGESGKTTFIKQMRIIHGKGFLDKERKQFTKNVFQNIFMA 80
            ||.||:.|..:........|:|:|||.||||:|..||||::|..|:..::..::...:..|...|
 Worm    24 SRAIDRALSKDHTDDLNRFKILLLGTAESGKSTIFKQMRVLHLDGYAKEDALEYLSIIHSNCMEA 88

  Fly    81 IQSMISAMDTLRIPYG---QQEHSKLADLVKSIDYKTVTRLEAPYL--NAIKTLWKDAGIKECYN 140
            :..::.|.....|.:.   |::.::..|..:.:  :....|..|.:  ..:..:|....::.||:
 Worm    89 LTQLVDACTAFGINHDITVQEDVNRFEDFKRKL--RDPEGLVIPVVIGRCMDRVWHSPSLQLCYD 151

  Fly   141 RRR-EYQLTDSTEYFLNDIARIERSDYQATDQDILHVRAPTTNIVEYPFNLDGFLIRLVDVAGQR 204
            .|| .:.|.||.:||:::|.|:...:|..:.|||:|.|..||.|.|..||......::|||.|||
 Worm   152 TRRFRFALLDSAKYFMDNIVRLTEDNYVPSIQDIVHCRISTTGINELAFNYKKMDFKMVDVGGQR 216

  Fly   205 TERRKWIHCFSNVTSIMFLVAMSEFDLSLAESENDNRMKESKALFHNIISFSWFQHSSVILFLNK 269
            :|||||||||.||..|:|:|:||::|....|....||||:|..:|..|:....|:|:|::|||||
 Worm   217 SERRKWIHCFDNVDMILFIVSMSDYDQLDPEDNKYNRMKQSYEIFKTIVHSDLFRHASIVLFLNK 281

  Fly   270 EDLFKKKILSTHLADYFPEYNGPKKDAKAAREFILYMFTSVNPDPYKCIYPHFTVATNTENIKFV 334
            .|:|.:|:.::.|...|..|.|...: ::|||||..:|.....|.:| .:...|.||:|.||..|
 Worm   282 YDVFVEKLKTSPLRRSFKNYEGDNSE-ESAREFIKKLFRRCITDRHK-FFVFETTATDTGNIDLV 344

  Fly   335 FTAVKDTILELHLSETNL 352
            |.:....|:..:|....|
 Worm   345 FGSAVAHIVNENLRSAGL 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17760NP_001036539.1 G_alpha 13..351 CDD:214595 117/340 (34%)
G-alpha 34..347 CDD:206639 111/318 (35%)
gpa-6NP_510189.1 G_alpha 22..361 CDD:214595 117/340 (34%)
G-alpha 43..357 CDD:206639 111/317 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162148
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 1 1.010 - - D373878at33208
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.760

Return to query results.
Submit another query.