DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17760 and gpa-11

DIOPT Version :9

Sequence 1:NP_001036539.1 Gene:CG17760 / 36385 FlyBaseID:FBgn0033756 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001254088.1 Gene:gpa-11 / 173759 WormBaseID:WBGene00001673 Length:529 Species:Caenorhabditis elegans


Alignment Length:365 Identity:124/365 - (33%)
Similarity:192/365 - (52%) Gaps:22/365 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SDQACEERRISREIDKFLKAEKKKARRELKLLVLGTGESGKTTFIKQMRIIHGKGFLDKERKQFT 70
            :|.|.:...|:|:::|    ||..:::.||:|:||..|.||:|..|||:|||..||.|.:...|.
 Worm   170 ADMARKNSLINRQLEK----EKIDSKKMLKILLLGGPECGKSTIFKQMKIIHMNGFSDLDYVNFR 230

  Fly    71 KNVFQNIFMAIQSMISAMDTLRIPYGQQEHSKLA-DLVKS--IDYKT-VTRLEAPYLNAIKTLWK 131
            ..::.||..::..::.|.:....|.......:.| :..||  :.|.| ...|.....:::..|:.
 Worm   231 YLIYSNIMQSMDQLLEAAEFFHFPPDDSPSIRRALNHYKSYKVRYSTSEVELNRELADSLSKLYN 295

  Fly   132 DAGIKECYNRRREYQLTDSTEYFLNDIARIERSDYQATDQDILHVRAPTTNIVEYPFNLDGFLIR 196
            ...||...||:.|.:|.||..|||:||.||...:|:.|:.|:|..|.|||.|.|..|......:|
 Worm   296 AEFIKSVLNRKNELKLLDSAVYFLDDIDRISAHEYKPTEMDVLRARVPTTGITEIEFPFKQASLR 360

  Fly   197 LVDVAGQRTERRKWIHCFSNVTSIMFLVAMSEFDLSLAESEN---------DNRMKESKALFHNI 252
            :|||.|||:|:|||||||.||..::|:.|:|.::|...:.||         .||::.|..||..|
 Worm   361 MVDVGGQRSEQRKWIHCFDNVNGVLFIAAISGYNLYDEDEENRKDDGTPTKTNRLRYSMELFKRI 425

  Fly   253 ISFSWF-QHSSVILFLNKEDLFKKKILSTHLADYFPEYNGPKKDAKAAREFILYMFT---SVNPD 313
            .:...| :.:::||||||.|:||:||....|...|..|.|......|.: ::...|:   |.:..
 Worm   426 ANHQCFSKKTAMILFLNKIDIFKEKIGKYPLTTCFKNYKGVNAFEPACK-YVTDRFSRLVSGDIQ 489

  Fly   314 PYKCIYPHFTVATNTENIKFVFTAVKDTILELHLSETNLL 353
            ..|.:|.|.|.||:|.||..||.:..|.|.::.:.:...:
 Worm   490 HEKPLYTHITNATDTRNIDRVFDSCMDVIFKISMEKVGFM 529

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17760NP_001036539.1 G_alpha 13..351 CDD:214595 122/354 (34%)
G-alpha 34..347 CDD:206639 117/329 (36%)
gpa-11NP_001254088.1 G_alpha 173..527 CDD:214595 123/358 (34%)
G-alpha 194..523 CDD:206639 117/329 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162151
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 1 1.010 - - D373878at33208
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.