DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17760 and gpa-14

DIOPT Version :9

Sequence 1:NP_001036539.1 Gene:CG17760 / 36385 FlyBaseID:FBgn0033756 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001020966.2 Gene:gpa-14 / 172269 WormBaseID:WBGene00001676 Length:408 Species:Caenorhabditis elegans


Alignment Length:362 Identity:112/362 - (30%)
Similarity:180/362 - (49%) Gaps:28/362 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RRISREIDKFLKAEKKKARRELKLLVLGTGESGKTTFIKQMRIIHGKGF-LDKERKQFTKNVFQN 76
            ||...||:|.|..|||.....:|:|:||...|||:|..|||:|||..|| .|:|..|:...:..|
 Worm    52 RRGHMEIEKELALEKKTYGSHIKILILGGPLSGKSTIFKQMQIIHVDGFKTDQELIQYRGLIDNN 116

  Fly    77 IFMAIQSMISAMDTLRIPYGQQEH------SKLADLVKSIDYKTVTRLEAPYLNAIKTLWKDAGI 135
            |......:|:....:.||....||      ...|.:..:...:|::.|    |..:...|....|
 Worm   117 IRDIYLQLIAGSRVVGIPLDPIEHITYEIDEIYAPMSDAFSVRTISEL----LEPLTEFWNSKQI 177

  Fly   136 KECYNRRREYQLTDSTEYFLNDIARIERSDYQATDQDILHVRAPTTNIVEYPFNLDGFLIRLVDV 200
            :|.|.||.|::|.|||:|:|.::.||....|....:||:|.|..|.:|....|...|..:.::||
 Worm   178 QEIYKRRCEFELLDSTKYYLENLTRIADPTYLPNQEDIVHSRKATMSINSIVFEYTGVSLLMIDV 242

  Fly   201 AGQRTERRKWIHCFSNVTSIMFLVAMSEFDLSLAES---------------ENDNRMKESKALFH 250
            .|||:||:||:|.|.:...::|::.::.:.....||               .|...||.:..:|:
 Worm   243 GGQRSERKKWLHLFDDAKVVLFVIDLTGYAKRSEESRMELSRFPKFFRDVGSNAYDMKVALKIFN 307

  Fly   251 NIISFSWFQHSSVILFLNKEDLFKKKILSTHLADYFPEYNGPKKDAKAAREFILYMFTSVNPDPY 315
            .:.:.|...::..:||.||.||||:.:...:|...|.:::| :...:...::|...|... ....
 Worm   308 EVAAASALANAVFLLFFNKVDLFKEILSQVNLQPCFSKFDG-ENTYEETSKYICEKFIRA-ASSK 370

  Fly   316 KCIYPHFTVATNTENIKFVFTAVKDTILELHLSETNL 352
            |.::||||.||||||:|.||.|..:::.:.:...|.|
 Worm   371 KSVFPHFTTATNTENVKLVFRACMESVFKANAKATGL 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17760NP_001036539.1 G_alpha 13..351 CDD:214595 110/359 (31%)
G-alpha 34..347 CDD:206639 101/334 (30%)
gpa-14NP_001020966.2 G_alpha 52..406 CDD:214595 110/359 (31%)
G-alpha 73..401 CDD:206639 101/333 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162150
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.