DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17760 and egl-30

DIOPT Version :9

Sequence 1:NP_001036539.1 Gene:CG17760 / 36385 FlyBaseID:FBgn0033756 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_740789.1 Gene:egl-30 / 171751 WormBaseID:WBGene00001196 Length:355 Species:Caenorhabditis elegans


Alignment Length:355 Identity:220/355 - (61%)
Similarity:289/355 - (81%) Gaps:2/355 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDCCLSDQACEERRISREIDKFLKAEKKKARRELKLLVLGTGESGKTTFIKQMRIIHGKGFLDKE 65
            |.||||::|.|::||::||:|.|:.:|:.||||||||:||||||||:|||||||||||:|:.:::
 Worm     1 MACCLSEEAREQKRINQEIEKQLQRDKRNARRELKLLLLGTGESGKSTFIKQMRIIHGQGYSEED 65

  Fly    66 RKQFTKNVFQNIFMAIQSMISAMDTLRIPYG--QQEHSKLADLVKSIDYKTVTRLEAPYLNAIKT 128
            ::...:.|:||:||||||||.|||||.|.:|  .:|..:.|.:|:.:|:::||..|.||::.||.
 Worm    66 KRAHIRLVYQNVFMAIQSMIRAMDTLDIKFGNESEELQEKAAVVREVDFESVTSFEEPYVSYIKE 130

  Fly   129 LWKDAGIKECYNRRREYQLTDSTEYFLNDIARIERSDYQATDQDILHVRAPTTNIVEYPFNLDGF 193
            ||:|:||:|||:||||||||||.:|:|:|:.|:...||..|:||||.||.|||.|:||||:|:..
 Worm   131 LWEDSGIQECYDRRREYQLTDSAKYYLSDLRRLAVPDYLPTEQDILRVRVPTTGIIEYPFDLEQI 195

  Fly   194 LIRLVDVAGQRTERRKWIHCFSNVTSIMFLVAMSEFDLSLAESENDNRMKESKALFHNIISFSWF 258
            :.|:|||.|||:|||||||||.||||||||||:||:|..|.|.:|:|||:||||||..||::.||
 Worm   196 IFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVECDNENRMEESKALFRTIITYPWF 260

  Fly   259 QHSSVILFLNKEDLFKKKILSTHLADYFPEYNGPKKDAKAAREFILYMFTSVNPDPYKCIYPHFT 323
            .:|||||||||:||.::|||.:|||||||||:||.:|..|||||||.||..:|||..|.||.|||
 Worm   261 TNSSVILFLNKKDLLEEKILYSHLADYFPEYDGPPRDPIAAREFILKMFVDLNPDADKIIYSHFT 325

  Fly   324 VATNTENIKFVFTAVKDTILELHLSETNLL 353
            .||:||||:|||.|||||||:.:|.|.||:
 Worm   326 CATDTENIRFVFAAVKDTILQHNLKEYNLV 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17760NP_001036539.1 G_alpha 13..351 CDD:214595 211/339 (62%)
G-alpha 34..347 CDD:206639 198/314 (63%)
egl-30NP_740789.1 G_alpha 13..353 CDD:214595 211/339 (62%)
G-alpha 34..349 CDD:206639 198/314 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S445
OMA 1 1.010 - - QHG54330
OrthoDB 1 1.010 - - D373878at33208
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.