DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17760 and Gnao1

DIOPT Version :9

Sequence 1:NP_001036539.1 Gene:CG17760 / 36385 FlyBaseID:FBgn0033756 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001106855.1 Gene:Gnao1 / 14681 MGIID:95775 Length:354 Species:Mus musculus


Alignment Length:355 Identity:161/355 - (45%)
Similarity:223/355 - (62%) Gaps:15/355 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDCCLS--DQACEERRISREIDKFLKAEKKKARRELKLLVLGTGESGKTTFIKQMRIIHGKGFLD 63
            |.|.||  ::|..||  |:.|:|.||.:...|.:::|||:||.|||||:|.:|||:|||..||..
Mouse     1 MGCTLSAEERAALER--SKAIEKNLKEDGISAAKDVKLLLLGAGESGKSTIVKQMKIIHEDGFSG 63

  Fly    64 KERKQFTKNVFQNIFMAIQSMISAMDTLRIPYGQQEHSKLADLVKSIDYKTVTRLE------APY 122
            ::.||:...|:.|...::.:::.|||||.:.||.:|....:.:|..:    |:|:|      |..
Mouse    64 EDVKQYKPVVYSNTIQSLAAIVRAMDTLGVEYGDKERKTDSKMVCDV----VSRMEDTEPFSAEL 124

  Fly   123 LNAIKTLWKDAGIKECYNRRREYQLTDSTEYFLNDIARIERSDYQATDQDILHVRAPTTNIVEYP 187
            |:|:..||.|:||:||:||.|||||.||.:|:|:.:.||...|||.|:||||..|..||.|||..
Mouse   125 LSAMMRLWGDSGIQECFNRSREYQLNDSAKYYLDSLDRIGAGDYQPTEQDILRTRVKTTGIVETH 189

  Fly   188 FNLDGFLIRLVDVAGQRTERRKWIHCFSNVTSIMFLVAMSEFDLSLAESENDNRMKESKALFHNI 252
            |.......||.||.|||:||:||||||.:||:|:|.||:|.:|..|.|.|..|||.||..||.:|
Mouse   190 FTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDETTNRMHESLKLFDSI 254

  Fly   253 ISFSWFQHSSVILFLNKEDLFKKKILSTHLADYFPEYNGPKKDAKAAREFILYMFTSVNPDPYKC 317
            .:..||..:|:||||||:|:|::||..:.|...||||.||....:|... |...:.|.|...:|.
Mouse   255 CNNKWFTDTSIILFLNKKDIFEEKIKKSPLTICFPEYTGPSAFTEAVAH-IQGQYESKNKSAHKE 318

  Fly   318 IYPHFTVATNTENIKFVFTAVKDTILELHL 347
            :|.|.|.||:|.||:|||.||.|.|:..:|
Mouse   319 VYSHVTCATDTNNIQFVFDAVTDVIIAKNL 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17760NP_001036539.1 G_alpha 13..351 CDD:214595 155/341 (45%)
G-alpha 34..347 CDD:206639 147/318 (46%)
Gnao1NP_001106855.1 G_alpha 14..352 CDD:214595 156/342 (46%)
G-alpha 34..348 CDD:206639 147/318 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.