DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17760 and LOC108179047

DIOPT Version :9

Sequence 1:NP_001036539.1 Gene:CG17760 / 36385 FlyBaseID:FBgn0033756 Length:353 Species:Drosophila melanogaster
Sequence 2:XP_021326059.1 Gene:LOC108179047 / 108179047 -ID:- Length:160 Species:Danio rerio


Alignment Length:159 Identity:52/159 - (32%)
Similarity:79/159 - (49%) Gaps:39/159 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 LAESENDNRMKESKALFHNIISFSWFQHSSVILFLNKEDLFKKKILS--THLADYFPEY------ 289
            :.|..|.||::|:.|||.:|.:..|.:..||||||||:|:..:|:|:  :.:.||||::      
Zfish     3 IREDNNTNRLREALALFRSIWNNRWLRTISVILFLNKQDMLAEKVLAGKSKIEDYFPDFAYYTLP 67

  Fly   290 ---------------NG---------PKKDAKAARE--FILYMFTSVNPDP----YKCIYPHFTV 324
                           ||         |.:|.:..|.  ||...|..::.:.    :.| |||||.
Zfish    68 DKVKKRKCVWKRKKRNGEDVSNITPDPGEDPRVTRAKFFIRDEFLKISTESGDGRHYC-YPHFTC 131

  Fly   325 ATNTENIKFVFTAVKDTILELHLSETNLL 353
            |.:||||:.||...:|.|..:||.:..||
Zfish   132 AVDTENIRRVFNDCRDIIQRMHLRQYELL 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17760NP_001036539.1 G_alpha 13..351 CDD:214595 50/155 (32%)
G-alpha 34..347 CDD:206639 48/151 (32%)
LOC108179047XP_021326059.1 P-loop_NTPase <1..154 CDD:328724 48/151 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586271
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.