DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17760 and GNA13

DIOPT Version :9

Sequence 1:NP_001036539.1 Gene:CG17760 / 36385 FlyBaseID:FBgn0033756 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_006563.2 Gene:GNA13 / 10672 HGNCID:4381 Length:377 Species:Homo sapiens


Alignment Length:359 Identity:149/359 - (41%)
Similarity:220/359 - (61%) Gaps:9/359 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CCLSDQACEERRISREIDKFLKAEKKKARRELKLLVLGTGESGKTTFIKQMRIIHGKGFLDKERK 67
            |.|:....|::|.|:||||.|..||...:|.:|:|:||.|||||:||:||||||||:.|..:.|:
Human    18 CLLTSGEAEQQRKSKEIDKCLSREKTYVKRLVKILLLGAGESGKSTFLKQMRIIHGQDFDQRARE 82

  Fly    68 QFTKNVFQNIFMAIQSMISAMDTLRIPYGQQEHSKLADLVKSIDYK--------TVTRLEAPYLN 124
            :|...::.|:...::.::.|.:.|.||:|...:.:..|.:.|.|.:        ..||:...||.
Human    83 EFRPTIYSNVIKGMRVLVDAREKLHIPWGDNSNQQHGDKMMSFDTRAPMAAQGMVETRVFLQYLP 147

  Fly   125 AIKTLWKDAGIKECYNRRREYQLTDSTEYFLNDIARIERSDYQATDQDILHVRAPTTNIVEYPFN 189
            ||:.||.|:||:..|:||||:||.:|.:|||:::.::...||..:.||||..|.||..|.||.|.
Human   148 AIRALWADSGIQNAYDRRREFQLGESVKYFLDNLDKLGEPDYIPSQQDILLARRPTKGIHEYDFE 212

  Fly   190 LDGFLIRLVDVAGQRTERRKWIHCFSNVTSIMFLVAMSEFDLSLAESENDNRMKESKALFHNIIS 254
            :.....::|||.|||:||::|..||.:||||:|||:.||||..|.|....||:.||..:|..|::
Human   213 IKNVPFKMVDVGGQRSERKRWFECFDSVTSILFLVSSSEFDQVLMEDRLTNRLTESLNIFETIVN 277

  Fly   255 FSWFQHSSVILFLNKEDLFKKKILSTHLADYFPEYNGPKKDAKAAREFILYMFTSVNPD-PYKCI 318
            ...|.:.|:||||||.||.::|:....:.|||.|:.|.....:..::|::..|.:...| ..|.:
Human   278 NRVFSNVSIILFLNKTDLLEEKVQIVSIKDYFLEFEGDPHCLRDVQKFLVECFRNKRRDQQQKPL 342

  Fly   319 YPHFTVATNTENIKFVFTAVKDTILELHLSETNL 352
            |.|||.|.|||||:.||..||||||..:|.:..|
Human   343 YHHFTTAINTENIRLVFRDVKDTILHDNLKQLML 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17760NP_001036539.1 G_alpha 13..351 CDD:214595 145/346 (42%)
G-alpha 34..347 CDD:206639 134/321 (42%)
GNA13NP_006563.2 G_alpha 29..375 CDD:214595 145/345 (42%)
G1 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 50..63 9/12 (75%)
G2 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 195..203 4/7 (57%)
G3 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 218..227 4/8 (50%)
G4 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 287..294 6/6 (100%)
G5 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 347..352 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151703
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.760

Return to query results.
Submit another query.