DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17760 and gnat1

DIOPT Version :9

Sequence 1:NP_001036539.1 Gene:CG17760 / 36385 FlyBaseID:FBgn0033756 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001096278.1 Gene:gnat1 / 100124843 XenbaseID:XB-GENE-1003264 Length:350 Species:Xenopus tropicalis


Alignment Length:351 Identity:149/351 - (42%)
Similarity:217/351 - (61%) Gaps:13/351 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ACEERRISREIDKFLKAEKKKARRELKLLVLGTGESGKTTFIKQMRIIHGKGFLDKERKQFTKNV 73
            |..|.:.|||::|.||.:.:|..|.:|||:||.|||||:|.:|||:|||..|:..:|..:|...:
 Frog     5 ASAEEKHSRELEKKLKEDAEKDARTVKLLLLGAGESGKSTIVKQMKIIHQDGYSLEECLEFISII 69

  Fly    74 FQNIFMAIQSMISAMDTLRIPYG----QQEHSKLADLVKSIDYKTVTRLEAPYLNAIKTLWKDAG 134
            :.|...::.:::.||:||.|.||    |.:..||..|..:||..::.:   ...:.|..||||.|
 Frog    70 YGNTLQSMLAIVRAMNTLNIQYGDPARQDDSRKLLHLADTIDEGSMPK---EMSDIIGRLWKDTG 131

  Fly   135 IKECYNRRREYQLTDSTEYFLNDIARIERSDYQATDQDILHVRAPTTNIVEYPFNLDGFLIRLVD 199
            |:.|::|..||||.||..|:|||:.|:....|..|:||:|..|..||.|:|..|.......|:.|
 Frog   132 IQACFDRASEYQLNDSAGYYLNDLERLVTPGYVPTEQDVLRSRVKTTGIIETQFGFKDLNFRMFD 196

  Fly   200 VAGQRTERRKWIHCFSNVTSIMFLVAMSEFDLSLAESENDNRMKESKALFHNIISFSWFQHSSVI 264
            |.|||:||:||||||..||.|:|:.|:|.:|:.|.|.:..|||.||..||::|.:..:|..:|::
 Frog   197 VGGQRSERKKWIHCFEGVTCIIFIAALSAYDMVLVEDDEVNRMHESLHLFNSICNHRYFATTSIV 261

  Fly   265 LFLNKEDLFKKKILSTHLADYFPEYNGPK--KDAKAAREFILYMFTSVN-PDPYKCIYPHFTVAT 326
            |||||:|:|.:||...||:..||:|:||.  :||.:   :|...|..:| ....|.||.|.|.||
 Frog   262 LFLNKKDVFTEKIKKAHLSICFPDYDGPNTYEDAGS---YIKTQFLELNMRRDVKEIYSHMTCAT 323

  Fly   327 NTENIKFVFTAVKDTILELHLSETNL 352
            :|||:||||.||.|.|::.:|.:..|
 Frog   324 DTENVKFVFDAVTDIIIKENLKDCGL 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17760NP_001036539.1 G_alpha 13..351 CDD:214595 146/344 (42%)
G-alpha 34..347 CDD:206639 137/319 (43%)
gnat1NP_001096278.1 G-alpha 30..344 CDD:206639 137/319 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.