DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaq and XLG3

DIOPT Version :9

Sequence 1:NP_725192.2 Gene:Galphaq / 36384 FlyBaseID:FBgn0004435 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001185125.1 Gene:XLG3 / 840083 AraportID:AT1G31930 Length:848 Species:Arabidopsis thaliana


Alignment Length:422 Identity:111/422 - (26%)
Similarity:189/422 - (44%) Gaps:95/422 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 KLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGYIKLVFQ-NIFMAMQSMIKAMDMLK---ISY 95
            ||||||...||.||..||.:.::|:.:|.|:.:. |||:.| |::..:..::...:..:   :|:
plant   432 KLLLLGIEGSGTSTIFKQAKFLYGNKFSVEELQD-IKLMVQSNMYRYLSILLDGRERFEEEALSH 495

  Fly    96 GQGEHSELADL--VMSIDYETVTT-------------FEDPYLNAIKT----------------- 128
            .:|.::...|.  ..:.|..||||             |.|..|:.|.|                 
plant   496 TRGLNAVEGDSGGEEANDEGTVTTPQSVYTLNPRLKHFSDWLLDIIATGDLDAFFPAATREYAPL 560

  Fly   129 ---LWDDAGIQECYDRRRE-YQLTDSAKYYLKDLDRVAQPAYLPTEQDILRVRVPTTGIIEYPFD 189
               :|.|..||..|.|:.| :.|.|.|:|:|.....|:...|.|:|:||:.....|.|     ..
plant   561 VEEVWKDPAIQATYRRKDELHFLPDVAEYFLSRAMEVSSNEYEPSERDIVYAEGVTQG-----NG 620

  Fly   190 LEEIRFSYLSDLARIEQADYLPTEQDILRARVPTTGILEYPFDLDGIVFRMVDVGGQ-RSERRKW 253
            |..:.|| |||.:.:.::  .|...|.|.:..|.              ::::.|..: .::..||
plant   621 LAFMEFS-LSDHSPMSES--YPENPDALSSPQPK--------------YQLIRVNAKGMNDSCKW 668

  Fly   254 IHCFENVTSIIFLVALSEYDQILFESDN------ENRMEESKALFRTIITYPWFQNSSVILFLNK 312
            :..||:|.::||.::||:||||....::      :|:|.:||.||.:::.:|.|:::..||.|||
plant   669 VEMFEDVRAVIFCISLSDYDQINITPESSGTVQYQNKMIQSKELFESMVKHPCFKDTPFILILNK 733

  Fly   313 KDLLEEKIMYSHLV--DYFPEY------DGPQRDAITAREFILRMFVDLNPDSEKIIYSHFT--- 366
            .|..|||:..:.|.  |:|.::      :..|..|..|..::...|        |::|...|   
plant   734 YDQFEEKLNRAPLTSCDWFSDFCPVRTNNNVQSLAYQAYFYVAMKF--------KLLYFSITGQK 790

  Fly   367 ------CATDTENIKLVFCAVKDTIMQNALKE 392
                  .|.|..|:...|..|::.:..:..||
plant   791 LFVWQARARDRANVDEGFKYVREVLKWDEEKE 822

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaqNP_725192.2 G-alpha 34..390 CDD:206639 109/418 (26%)
XLG3NP_001185125.1 G-alpha 429..815 CDD:278904 109/413 (26%)
G-alpha 431..818 CDD:206639 109/416 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10218
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.