DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaq and XLG2

DIOPT Version :9

Sequence 1:NP_725192.2 Gene:Galphaq / 36384 FlyBaseID:FBgn0004435 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_195165.2 Gene:XLG2 / 829589 AraportID:AT4G34390 Length:861 Species:Arabidopsis thaliana


Alignment Length:384 Identity:91/384 - (23%)
Similarity:154/384 - (40%) Gaps:114/384 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 EQKRINQEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGYIKLVFQ 75
            |||.:|                  ||||:|:.:.|.:|..||.|.::...:|.|| |..||.:.|
plant   458 EQKMLN------------------KLLLIGSEKGGATTIYKQARSLYNVSFSLED-RERIKFIIQ 503

  Fly    76 -NIFMAMQSMIKAMDMLKISYGQGEHS--------------------ELADLVMSIDYETVTTFE 119
             |::..:..:::|.:..:......:.|                    ..:|.|:.       ..|
plant   504 TNLYTYLAMVLEAHERFEKEMSNDQSSGNVGDETSAKPGNSINPRLKHFSDWVLK-------EKE 561

  Fly   120 DPYL---------NA--IKTLWDDAGIQECYDRRREYQLTDSAKYYLKDLDRVAQPAYLPTEQDI 173
            |..|         ||  :..||....||..|.|.|: .|..:|.|:|:.:..:::..|.|::.||
plant   562 DGNLKIFPPSSRENAQTVADLWRVPAIQATYKRLRD-TLPRNAVYFLERILEISRSEYDPSDMDI 625

  Fly   174 LRVRVPTTGIIEYPFDLEEIRFSYLSDLARIEQADYLPTEQDILRARVPTTGILEYPFDLDGIVF 238
            |:..    |:.... .|..:.||:.|           .::::.|.:        :|..|.| :.:
plant   626 LQAE----GLSSME-GLSCVDFSFPS-----------TSQEESLES--------DYQHDTD-MKY 665

  Fly   239 RMVDVGGQRSERRKW--IHCFENVTSIIFLVALSEYDQILFESDNE--NRMEESKALFRTIITYP 299
            :::.: ..||....|  :..||:...:||.|:|::|.:.:.:.:..  |:|..:|.||..::|:|
plant   666 QLIRL-NPRSLGENWKLLEMFEDADLVIFCVSLTDYAENIEDGEGNIVNKMLATKQLFENMVTHP 729

  Fly   300 WFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAITAREFILR---MFVDLNP 355
            ...|...:|.|.|.|||||||                      .|..||   .|.|.||
plant   730 SLANKRFLLVLTKFDLLEEKI----------------------EEVPLRTCEWFEDFNP 766

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaqNP_725192.2 G-alpha 34..390 CDD:206639 87/361 (24%)
XLG2NP_195165.2 G-alpha 464..840 CDD:206639 87/360 (24%)
G-alpha 464..837 CDD:278904 87/360 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10218
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.