DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaq and Gnaq

DIOPT Version :9

Sequence 1:NP_725192.2 Gene:Galphaq / 36384 FlyBaseID:FBgn0004435 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_112298.2 Gene:Gnaq / 81666 RGDID:620770 Length:359 Species:Rattus norvegicus


Alignment Length:395 Identity:292/395 - (73%)
Similarity:320/395 - (81%) Gaps:43/395 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MECCLSEEAKEQKRINQEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDED 65
            |.|||||||||.:|||.|||:||||||||||||||||||||||||||||||||||||||||||||
  Rat     7 MACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDED 71

  Fly    66 KRGYIKLVFQNIFMAMQSMIKAMDMLKISYGQGEHSELADLVMSIDYETVTTFEDPYLNAIKTLW 130
            |||:.|||:||||.|||:||:|||.|||.|....:...|.||..:|.|.|:.||:||::|||:||
  Rat    72 KRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLW 136

  Fly   131 DDAGIQECYDRRREYQLTDSAKYYLKDLDRVAQPAYLPTEQDILRVRVPTTGIIEYPFDLEEIRF 195
            :|.||||||||||||||:||.||||.||||||.|:||||:||:|||||||||||||||||:    
  Rat   137 NDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPSYLPTQQDVLRVRVPTTGIIEYPFDLQ---- 197

  Fly   196 SYLSDLARIEQADYLPTEQDILRARVPTTGILEYPFDLDGIVFRMVDVGGQRSERRKWIHCFENV 260
                                                   .::|||||||||||||||||||||||
  Rat   198 ---------------------------------------SVIFRMVDVGGQRSERRKWIHCFENV 223

  Fly   261 TSIIFLVALSEYDQILFESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHL 325
            |||:||||||||||:|.||||||||||||||||||||||||||||||||||||||||||||||||
  Rat   224 TSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHL 288

  Fly   326 VDYFPEYDGPQRDAITAREFILRMFVDLNPDSEKIIYSHFTCATDTENIKLVFCAVKDTIMQNAL 390
            ||||||||||||||..||||||:|||||||||:||||||||||||||||:.||.||||||:|..|
  Rat   289 VDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNL 353

  Fly   391 KEFNL 395
            ||:||
  Rat   354 KEYNL 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaqNP_725192.2 G-alpha 34..390 CDD:206639 259/355 (73%)
GnaqNP_112298.2 G-alpha 40..353 CDD:206639 259/355 (73%)
G1 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 41..54 12/12 (100%)
G2 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 178..186 6/7 (86%)
G3 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 201..210 8/8 (100%)
G4 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 270..277 6/6 (100%)
G5 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 329..334 4/4 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340969
Domainoid 1 1.000 530 1.000 Domainoid score I275
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 562 1.000 Inparanoid score I1047
OMA 1 1.010 - - QHG54330
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 1 1.000 - - otm45451
orthoMCL 1 0.900 - - OOG6_104168
Panther 1 1.100 - - LDO PTHR10218
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X53
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.