DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaq and Gnai2

DIOPT Version :9

Sequence 1:NP_725192.2 Gene:Galphaq / 36384 FlyBaseID:FBgn0004435 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_112297.1 Gene:Gnai2 / 81664 RGDID:620243 Length:355 Species:Rattus norvegicus


Alignment Length:399 Identity:179/399 - (44%)
Similarity:232/399 - (58%) Gaps:49/399 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MECCLSEEAKEQKRINQEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDED 65
            |.|.:|.|.|.....::.|:|.||.|...|.||:||||||.|||||||.:|||:|||..|||:|:
  Rat     1 MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDGYSEEE 65

  Fly    66 KRGYIKLVFQNIFMAMQSMIKAMDMLKISYGQGEHSELAD--LVMSIDYETVTTFEDPYLNAIKT 128
            .|.|..:|:.|...::.:::|||..|:|.:...:.::.|.  ..:|...|......:.....|:.
  Rat    66 CRQYRAVVYSNTIQSIMAIVKAMGNLQIDFADPQRADDARQLFALSCAAEEQGMLPEDLSGVIRR 130

  Fly   129 LWDDAGIQECYDRRREYQLTDSAKYYLKDLDRVAQPAYLPTEQDILRVRVPTTGIIEYPFDLEEI 193
            ||.|.|:|.|:.|.|||||.|||.|||.||:|:|                               
  Rat   131 LWADHGVQACFGRSREYQLNDSAAYYLNDLERIA------------------------------- 164

  Fly   194 RFSYLSDLARIEQADYLPTEQDILRARVPTTGILEYPFDLDGIVFRMVDVGGQRSERRKWIHCFE 258
                        |:||:||:||:||.||.||||:|..|....:.|:|.|||||||||:|||||||
  Rat   165 ------------QSDYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFE 217

  Fly   259 NVTSIIFLVALSEYDQILFESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYS 323
            .||:|||.||||.||.:|.|.:..|||.||..||.:|....||.::|:|||||||||.||||..|
  Rat   218 GVTAIIFCVALSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKITQS 282

  Fly   324 HLVDYFPEYDGPQR-DAITAREFILRMFVDLNPDSE-KIIYSHFTCATDTENIKLVFCAVKDTIM 386
            .|...||||.|..: |  .|..:|...|.|||...: |.||:||||||||:|::.||.||.|.|:
  Rat   283 PLTICFPEYTGANKYD--EAASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVII 345

  Fly   387 QNALKEFNL 395
            :|.||:..|
  Rat   346 KNNLKDCGL 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaqNP_725192.2 G-alpha 34..390 CDD:206639 163/359 (45%)
Gnai2NP_112297.1 G-alpha 34..349 CDD:206639 163/359 (45%)
G1 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 35..48 11/12 (92%)
G2 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 174..182 5/7 (71%)
G3 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 197..206 6/8 (75%)
G4 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 266..273 6/6 (100%)
G5 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 325..330 4/4 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X53
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.