DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaq and LOC797518

DIOPT Version :9

Sequence 1:NP_725192.2 Gene:Galphaq / 36384 FlyBaseID:FBgn0004435 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_021331576.1 Gene:LOC797518 / 797518 -ID:- Length:341 Species:Danio rerio


Alignment Length:377 Identity:110/377 - (29%)
Similarity:190/377 - (50%) Gaps:60/377 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 KRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGYIKLVFQNIFMAMQSMIKAMDML 91
            ||:||..|.:||:|..:||.|||.||:|:|:|..::.:.:.|:.:.:::||...|..::|..:.|
Zfish    12 KREARMPLLILLVGMNDSGTSTFFKQIRLINGEDFNLKQRLGFREAIYENIIQGMWVLVKERNKL 76

  Fly    92 KISYGQGEHSEL------ADLVMSIDYETVTTFEDPYLNAIKTLWDDAGIQECYDRR----REYQ 146
            .|.. |...:|:      :|..:.:.:...:.|: ||:.|:.:||.|:||||.|.|.    .||.
Zfish    77 GIPL-QNSANEIHEISFTSDDCLRVKFTEPSAFQ-PYVEAVDSLWKDSGIQETYRRSDFKGHEYF 139

  Fly   147 LTDSAKYYLKDLDRVAQPAYLPTEQDILRVRVPTTGIIEYPFDLEEIRFSYLSDLARIEQADYLP 211
            :.||.||:..::.|:.|..|||..||||..|...|.:.:..:.|.:..|.       :.|:..||
Zfish   140 ICDSVKYHFDNIQRIGQLDYLPHNQDILHARSRWTTLEDMYYVLRDTPFV-------VAQSSILP 197

  Fly   212 TEQDILRARVPTTGILEYPFDLDGIVFRMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQIL 276
            .   |.|.:                 |...|                  |:|:|::..|:||::|
Zfish   198 F---IARMK-----------------FNFRD------------------TTILFIIGSSDYDRML 224

  Fly   277 FESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAIT 341
            ::|   |.:.:|.::|::||.:.::.:|::||..||.|||.||:..:.:..:|||:.|.......
Zfish   225 YDS---NCLADSLSIFKSIINHKYYSSSTIILLFNKMDLLREKVQTADIRKHFPEFQGDPHRLED 286

  Fly   342 AREFILRMFVDLNPDSEKIIYSHFTCATDTENIKLVFCAVKDTIMQNALKEF 393
            .::|:::.|......:...||.|...|.|||||:.|:..:|..|:....|:|
Zfish   287 VQKFLVQSFKMRKLKNSGPIYYHMITAVDTENIRTVYNTIKHAILSKNFKDF 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaqNP_725192.2 G-alpha 34..390 CDD:206639 104/365 (28%)
LOC797518XP_021331576.1 G-alpha 21..334 CDD:206639 103/362 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.