DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaq and gnaz

DIOPT Version :9

Sequence 1:NP_725192.2 Gene:Galphaq / 36384 FlyBaseID:FBgn0004435 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_005155690.2 Gene:gnaz / 564915 ZFINID:ZDB-GENE-090420-3 Length:355 Species:Danio rerio


Alignment Length:408 Identity:173/408 - (42%)
Similarity:221/408 - (54%) Gaps:67/408 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MECCLSEEAKEQKRINQEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDED 65
            |.|..|.|.||..|.::.|::.||.:.:..|||:|||||||..|||||.:|||:|||..|::.|.
Zfish     1 MGCRQSTEEKEAARRSRRIDRHLRSESQRQRREIKLLLLGTSNSGKSTIVKQMKIIHSGGFNLEA 65

  Fly    66 KRGYIKLVFQNIFMAMQSMIKAMDMLKISYGQGEHSELADLVMSIDYETVTTF------------ 118
            .:.|..|:..|...::..:|:|:..|||.:...:.:          |:.|..|            
Zfish    66 CKEYKPLILYNAIDSLTRIIRALATLKIDFHNPDRA----------YDAVQLFALTGPAESKGEI 120

  Fly   119 EDPYLNAIKTLWDDAGIQECYDRRREYQLTDSAKYYLKDLDRVAQPAYLPTEQDILRVRVPTTGI 183
            ....|..:|.||.|.|:|||:.|..||.|.|:..|||.||||::.|.|:||.:||||.|..||||
Zfish   121 TPELLGVMKRLWADPGVQECFCRSNEYHLEDNTAYYLNDLDRISAPEYIPTVEDILRSRDMTTGI 185

  Fly   184 IEYPFDLEEIRFSYLSDLARIEQADYLPTEQDILRARVPTTGILEYPFDLDGIVFRMVDVGGQRS 248
            :|..|..:|                                           :.|:|||||||||
Zfish   186 VENKFTFKE-------------------------------------------LTFKMVDVGGQRS 207

  Fly   249 ERRKWIHCFENVTSIIFLVALSEYDQILFESDNENRMEESKALFRTIITYPWFQNSSVILFLNKK 313
            ||:|||||||.||:|||.|.||.||..|:|.:..:||.||..||.:|....||.|:|:|||||||
Zfish   208 ERKKWIHCFEGVTAIIFCVELSGYDLKLYEDNQTSRMAESLRLFDSICNNNWFTNTSLILFLNKK 272

  Fly   314 DLLEEKIMYSHLVDYFPEYDGPQRDAITAREFILRMFVDLNPDSE-KIIYSHFTCATDTENIKLV 377
            |||.|||....|...|.:|.| |.....|..::.|.|.|||.:.| |.|||||||||||.||:.|
Zfish   273 DLLAEKIKRIPLTVCFADYKG-QNTYEEAAVYVQRQFEDLNRNKETKEIYSHFTCATDTSNIQFV 336

  Fly   378 FCAVKDTIMQNALKEFNL 395
            |.||.|.|:||.||...|
Zfish   337 FDAVTDVIIQNNLKYIGL 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaqNP_725192.2 G-alpha 34..390 CDD:206639 157/368 (43%)
gnazXP_005155690.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.