DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaq and gna15.4

DIOPT Version :9

Sequence 1:NP_725192.2 Gene:Galphaq / 36384 FlyBaseID:FBgn0004435 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001038454.1 Gene:gna15.4 / 562625 ZFINID:ZDB-GENE-050208-781 Length:361 Species:Danio rerio


Alignment Length:395 Identity:150/395 - (37%)
Similarity:230/395 - (58%) Gaps:48/395 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CCLSEEAKEQKRINQEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKR 67
            ||||:..:.....|:||:......::..|||:|||:||:.||||||.:||:::.||:|||::::|
Zfish    12 CCLSKNKRNAIAKNKEIDLDFIEQRKRERREIKLLVLGSAESGKSTLLKQIKMSHGNGYSEDERR 76

  Fly    68 GYIKLVFQNIFMAMQSMIKAMDMLKISYGQGEHSELADLVMSIDYETVTTFEDPYLNAIKTLWDD 132
            |:.|||.||||::|::|..||..|:|.|...::..:..|::.....:.......::..|:.||.|
Zfish    77 GFSKLVHQNIFLSMKTMTDAMSELRIPYTNPQNQVIETLMLVSPLISTGHMCGIFVEPIRHLWAD 141

  Fly   133 AGIQECYD--RRREYQLTDSAKYYLKDLDRVAQPAYLPTEQDILRVRVPTTGIIEYPFDLEEIRF 195
            .|.:.|:.  ::....|| |.:|::..||::....|:||.||||||:..|..|.|          
Zfish   142 EGFKNCFKLCKKNHRHLT-SLEYFVDRLDQITANNYIPTIQDILRVQSSTNAIAE---------- 195

  Fly   196 SYLSDLARIEQADYLPTEQDILRARVPTTGILEYPFDLDGIVFRMVDVGGQRSERRKWIHCFENV 260
                                           |..|..:  ..||.::|||||.:||||||.||||
Zfish   196 -------------------------------LSIPMQI--FTFRFINVGGQRGQRRKWIHHFENV 227

  Fly   261 TSIIFLVALSEYDQILFESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHL 325
            |::||:.:|||||:.| |.:|:||||||.:||.::.:.||...||::|.|||||.|.:||.:|||
Zfish   228 TTVIFVASLSEYDEFL-EENNKNRMEESLSLFNSVTSSPWLAQSSILLLLNKKDFLAKKIQFSHL 291

  Fly   326 VDYFPEYDGPQRDAITAREFILRMFVDLNPDSEKIIYSHFTCATDTENIKLVFCAVKDTIMQNAL 390
            ..:|||:.|..:||..|.:|||:.: :.|...:::|||.|.||||..:.|:.|.||||||::..:
Zfish   292 KTFFPEFTGKIQDADDAMKFILKSY-ERNVTPDQLIYSQFICATDFIDTKIFFDAVKDTILRQTM 355

  Fly   391 KEFNL 395
            ..:.:
Zfish   356 ANYEV 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaqNP_725192.2 G-alpha 34..390 CDD:206639 140/357 (39%)
gna15.4NP_001038454.1 G_alpha 22..355 CDD:214595 146/378 (39%)
G-alpha 43..355 CDD:206639 140/357 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.