DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaq and gna14a

DIOPT Version :9

Sequence 1:NP_725192.2 Gene:Galphaq / 36384 FlyBaseID:FBgn0004435 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_683989.2 Gene:gna14a / 556160 ZFINID:ZDB-GENE-081105-76 Length:354 Species:Danio rerio


Alignment Length:393 Identity:256/393 - (65%)
Similarity:305/393 - (77%) Gaps:43/393 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CCLSEEAKEQKRINQEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKR 67
            ||:|.|.||::||||||:||||:||:|:|||||||||||||||||||||||||||||||:|:||:
Zfish     4 CCMSAEEKERQRINQEIDKQLRKDKKDSRRELKLLLLGTGESGKSTFIKQMRIIHGSGYTDDDKK 68

  Fly    68 GYIKLVFQNIFMAMQSMIKAMDMLKISYGQGEHSELADLVMSIDYETVTTFEDPYLNAIKTLWDD 132
            |:||||.||...|||||::|||||||:|...|:...:.||..|:.:.:.:.::..:.|:.:||.|
Zfish    69 GFIKLVHQNTLSAMQSMVRAMDMLKIAYANSENQAHSALVNDIEVDKIMSLDETQVKALSSLWSD 133

  Fly   133 AGIQECYDRRREYQLTDSAKYYLKDLDRVAQPAYLPTEQDILRVRVPTTGIIEYPFDLEEIRFSY 197
            :||||||||||||||||||||||.||||:|..||:|||||||||||||||||             
Zfish   134 SGIQECYDRRREYQLTDSAKYYLSDLDRIANAAYVPTEQDILRVRVPTTGII------------- 185

  Fly   198 LSDLARIEQADYLPTEQDILRARVPTTGILEYPFDLDGIVFRMVDVGGQRSERRKWIHCFENVTS 262
                                          |||||||.::|||||||||||||||||||||||||
Zfish   186 ------------------------------EYPFDLDNVIFRMVDVGGQRSERRKWIHCFENVTS 220

  Fly   263 IIFLVALSEYDQILFESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVD 327
            ||||||||||||:|.|.|||||||||||||:|||||||||:|||||||||.|:|:|||:|||:..
Zfish   221 IIFLVALSEYDQVLAECDNENRMEESKALFKTIITYPWFQSSSVILFLNKTDILKEKIVYSHVAT 285

  Fly   328 YFPEYDGPQRDAITAREFILRMFVDLNPDSEKIIYSHFTCATDTENIKLVFCAVKDTIMQNALKE 392
            ||||:.||:.|...|:||||:|:.:.|.|.:|.||||||||||||||:|:|.||||||:::.|||
Zfish   286 YFPEFTGPKNDPKAAQEFILKMYQEENEDKDKTIYSHFTCATDTENIRLIFAAVKDTILRHNLKE 350

  Fly   393 FNL 395
            |||
Zfish   351 FNL 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaqNP_725192.2 G-alpha 34..390 CDD:206639 228/355 (64%)
gna14aXP_683989.2 G_alpha 15..352 CDD:214595 247/379 (65%)
G-alpha 35..348 CDD:206639 228/355 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.