DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaq and gna11b

DIOPT Version :9

Sequence 1:NP_725192.2 Gene:Galphaq / 36384 FlyBaseID:FBgn0004435 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001007774.1 Gene:gna11b / 493613 ZFINID:ZDB-GENE-041121-9 Length:359 Species:Danio rerio


Alignment Length:395 Identity:282/395 - (71%)
Similarity:315/395 - (79%) Gaps:43/395 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MECCLSEEAKEQKRINQEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDED 65
            |.|||||||||.||||.||:||||||||||||||||||||||||||||||||||||||:||:|||
Zfish     7 MACCLSEEAKESKRINAEIDKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGAGYTDED 71

  Fly    66 KRGYIKLVFQNIFMAMQSMIKAMDMLKISYGQGEHSELADLVMSIDYETVTTFEDPYLNAIKTLW 130
            |||:.|||:||||.:||:||:|.:.|||.|...::...|.||..:|.|.|.:|:.||:||:|.||
Zfish    72 KRGFTKLVYQNIFTSMQAMIRATETLKIGYKYEQNKANAMLVKEVDIEKVMSFDHPYINAVKMLW 136

  Fly   131 DDAGIQECYDRRREYQLTDSAKYYLKDLDRVAQPAYLPTEQDILRVRVPTTGIIEYPFDLEEIRF 195
            .|.||||.|||||||||:||.||||.||||:|:.:||||:||:||||:||||||||||||:    
Zfish   137 SDPGIQEAYDRRREYQLSDSTKYYLSDLDRIAESSYLPTQQDVLRVRIPTTGIIEYPFDLQ---- 197

  Fly   196 SYLSDLARIEQADYLPTEQDILRARVPTTGILEYPFDLDGIVFRMVDVGGQRSERRKWIHCFENV 260
                                                   .|:|||||||||||||||||||||||
Zfish   198 ---------------------------------------SIIFRMVDVGGQRSERRKWIHCFENV 223

  Fly   261 TSIIFLVALSEYDQILFESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHL 325
            |||:||||||||||:|.|||||||||||||||||||||||||||||||||||||||||||.||||
Zfish   224 TSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKISYSHL 288

  Fly   326 VDYFPEYDGPQRDAITAREFILRMFVDLNPDSEKIIYSHFTCATDTENIKLVFCAVKDTIMQNAL 390
            ||||||:|||||||..||||||:|||||||||:||||||||||||||||:.||.||||||:|..|
Zfish   289 VDYFPEFDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNL 353

  Fly   391 KEFNL 395
            ||:||
Zfish   354 KEYNL 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaqNP_725192.2 G-alpha 34..390 CDD:206639 248/355 (70%)
gna11bNP_001007774.1 G_alpha 19..357 CDD:214595 270/380 (71%)
G-alpha 40..353 CDD:206639 248/355 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580851
Domainoid 1 1.000 519 1.000 Domainoid score I293
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 551 1.000 Inparanoid score I1099
OMA 1 1.010 - - QHG54330
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 1 1.000 - - mtm6605
orthoMCL 1 0.900 - - OOG6_104168
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.660

Return to query results.
Submit another query.