DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaq and gna14

DIOPT Version :9

Sequence 1:NP_725192.2 Gene:Galphaq / 36384 FlyBaseID:FBgn0004435 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001008054.1 Gene:gna14 / 493416 XenbaseID:XB-GENE-945095 Length:354 Species:Xenopus tropicalis


Alignment Length:393 Identity:263/393 - (66%)
Similarity:310/393 - (78%) Gaps:43/393 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CCLSEEAKEQKRINQEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKR 67
            |||:.|.||.:|||.||||||||||||||||||||||||||||||||||||||||||||:|||::
 Frog     4 CCLTAEEKESQRINAEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYTDEDRK 68

  Fly    68 GYIKLVFQNIFMAMQSMIKAMDMLKISYGQGEHSELADLVMSIDYETVTTFEDPYLNAIKTLWDD 132
            |:.|||:||||.:||:||:|||.|:|.|...::.|.|..|..::.:.|::.|..::.|||.||:|
 Frog    69 GFTKLVYQNIFTSMQAMIRAMDTLRIQYSSEQNMENALTVREVEVDKVSSLERKHVEAIKKLWED 133

  Fly   133 AGIQECYDRRREYQLTDSAKYYLKDLDRVAQPAYLPTEQDILRVRVPTTGIIEYPFDLEEIRFSY 197
            .||||||||||||||:||.||||.|:||::.|:::||:||:||||||||||||||||||      
 Frog   134 EGIQECYDRRREYQLSDSTKYYLSDIDRISNPSFIPTQQDVLRVRVPTTGIIEYPFDLE------ 192

  Fly   198 LSDLARIEQADYLPTEQDILRARVPTTGILEYPFDLDGIVFRMVDVGGQRSERRKWIHCFENVTS 262
                                                 .|:|||||||||||||||||||||||||
 Frog   193 -------------------------------------NIIFRMVDVGGQRSERRKWIHCFENVTS 220

  Fly   263 IIFLVALSEYDQILFESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVD 327
            ||||||||||||:|.|.|||||||||||||||||||||||||||||||||||||:||||||||:|
 Frog   221 IIFLVALSEYDQVLAECDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLQEKIMYSHLID 285

  Fly   328 YFPEYDGPQRDAITAREFILRMFVDLNPDSEKIIYSHFTCATDTENIKLVFCAVKDTIMQNALKE 392
            ||||:.||::|:.:||:|||:::.|.|||.||:||||||||||||||:.||.||||||:|..|:|
 Frog   286 YFPEFTGPKQDSQSARDFILKLYQDQNPDKEKVIYSHFTCATDTENIRFVFAAVKDTILQLNLRE 350

  Fly   393 FNL 395
            |||
 Frog   351 FNL 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaqNP_725192.2 G-alpha 34..390 CDD:206639 233/355 (66%)
gna14NP_001008054.1 G-alpha 35..348 CDD:206639 233/355 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 532 1.000 Domainoid score I284
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 564 1.000 Inparanoid score I1071
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 1 1.000 - - otm48526
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.050

Return to query results.
Submit another query.