DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaq and gna14

DIOPT Version :9

Sequence 1:NP_725192.2 Gene:Galphaq / 36384 FlyBaseID:FBgn0004435 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001003753.1 Gene:gna14 / 445297 ZFINID:ZDB-GENE-040808-7 Length:354 Species:Danio rerio


Alignment Length:395 Identity:234/395 - (59%)
Similarity:294/395 - (74%) Gaps:43/395 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ECCLSEEAKEQKRINQEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDK 66
            |||||.|.||:.||:||||::|:.|:|.:.:||||||||||||||||||||||||||.||::|||
Zfish     3 ECCLSGEEKEKMRIHQEIERKLKMDRRSSNKELKLLLLGTGESGKSTFIKQMRIIHGKGYTEEDK 67

  Fly    67 RGYIKLVFQNIFMAMQSMIKAMDMLKISYGQGEHSELADLVMSIDYETVTTFEDPYLNAIKTLWD 131
            |.:.|||:||:|.::|||:|||:.|||.:.:.::...|.::..::.|:|.|.|..|..|||::|.
Zfish    68 RSFAKLVYQNVFTSIQSMLKAMENLKIPFAESKNETFAAMLKEVEAESVQTMEAKYAEAIKSVWK 132

  Fly   132 DAGIQECYDRRREYQLTDSAKYYLKDLDRVAQPAYLPTEQDILRVRVPTTGIIEYPFDLEEIRFS 196
            |.|:|:||:|||||||:||.||||.|:||:|...|:||.||||||||||||||||.|||:     
Zfish   133 DQGLQKCYERRREYQLSDSTKYYLDDMDRIAAGFYMPTLQDILRVRVPTTGIIEYVFDLQ----- 192

  Fly   197 YLSDLARIEQADYLPTEQDILRARVPTTGILEYPFDLDGIVFRMVDVGGQRSERRKWIHCFENVT 261
                                                  .::|||||||||:||||||||||||||
Zfish   193 --------------------------------------SVLFRMVDVGGQKSERRKWIHCFENVT 219

  Fly   262 SIIFLVALSEYDQILFESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLV 326
            |:|||||||||||.||||.||||||||||||:|||:|||||:|||||||||.|:|::||:.|.|.
Zfish   220 SVIFLVALSEYDQFLFESANENRMEESKALFKTIISYPWFQDSSVILFLNKTDILKDKILKSDLA 284

  Fly   327 DYFPEYDGPQRDAITAREFILRMFVDLNPDSEKIIYSHFTCATDTENIKLVFCAVKDTIMQNALK 391
            .|:|::.||:.||..|.:|||:|:.:.|||.:|.||:|||||||||||:.||.||||||::|.|.
Zfish   285 KYYPQFTGPKNDADAAMKFILKMYEEQNPDKQKRIYAHFTCATDTENIRFVFEAVKDTILRNTLS 349

  Fly   392 EFNLG 396
            .||||
Zfish   350 AFNLG 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaqNP_725192.2 G-alpha 34..390 CDD:206639 211/355 (59%)
gna14NP_001003753.1 G_alpha 15..348 CDD:214595 221/375 (59%)
G-alpha 35..348 CDD:206639 211/355 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.