DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaq and gnal2

DIOPT Version :9

Sequence 1:NP_725192.2 Gene:Galphaq / 36384 FlyBaseID:FBgn0004435 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001353644.1 Gene:gnal2 / 407724 ZFINID:ZDB-GENE-040718-441 Length:379 Species:Danio rerio


Alignment Length:423 Identity:155/423 - (36%)
Similarity:230/423 - (54%) Gaps:78/423 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 CLSEEAKEQKRI--------NQEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSG 60
            ||.....|.:||        |::|||||:::::..|...:|||||.|||||||.:|||:|:|.:|
Zfish     3 CLGSSKTEDQRIDEKAQREANKKIEKQLQKERQAYRATHRLLLLGAGESGKSTIVKQMKILHVNG 67

  Fly    61 YSDEDKRGYIKLVFQNIFMAMQSMIKAMDML--KISYGQGEHSELADLVMSI----DYETVTTFE 119
            ::.|:|:..|:.:.:|:..|:.:::.||..|  .|.....|.....|.:.||    |::    :.
Zfish    68 FNAEEKKQKIQDIRKNVKDAIVTIVSAMSTLIPPIPLANPEDQFRIDYIKSIAPLSDFD----YT 128

  Fly   120 DPYLNAIKTLWDDAGIQECYDRRREYQLTDSAKYYLKDLDRVAQPAYLPTEQDILRVRVPTTGII 184
            ..:.:..|.||:|.|::.||:|..||||.|.|:|:|..:|.|                       
Zfish   129 QEFFDHAKKLWEDEGVKACYERSNEYQLIDCAQYFLDRIDAV----------------------- 170

  Fly   185 EYPFDLEEIRFSYLSDLARIEQADYLPTEQDILRARVPTTGILEYPFDLDGIVFRMVDVGGQRSE 249
                                .|:||.||:||:||.||.|:||.|..|.:|.:.|.|.||||||.|
Zfish   171 --------------------RQSDYTPTDQDLLRCRVLTSGIFETRFQVDKVNFHMFDVGGQRDE 215

  Fly   250 RRKWIHCFENVTSIIFLVALSEYDQILFESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKD 314
            |||||.||.:||:|||:||.|.|:.::.|.:|.||:.|:.||||:|....|.:..||||||||:|
Zfish   216 RRKWIQCFNDVTAIIFVVASSSYNMVIREDNNTNRLREALALFRSIWNNRWLRTISVILFLNKQD 280

  Fly   315 LLEEKIM--YSHLVDYFPEY-----------DGPQRDAITAREFILR-MFVDLNP---DSEKIIY 362
            :|.||::  .|.:.||||::           |..:...:|..:|.:| .|:.::.   |.....|
Zfish   281 MLAEKVLAGKSKIEDYFPDFAYYTLPDKVTPDPGEDPRVTRAKFFIRDEFLKISTESGDGRHYCY 345

  Fly   363 SHFTCATDTENIKLVFCAVKDTIMQNALKEFNL 395
            .|||||.|||||:.||...:|.|.:..|:::.|
Zfish   346 PHFTCAVDTENIRRVFNDCRDIIQRMHLRQYEL 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaqNP_725192.2 G-alpha 34..390 CDD:206639 141/378 (37%)
gnal2NP_001353644.1 G-alpha 41..373 CDD:206639 141/378 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.