DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaq and Galphaf

DIOPT Version :9

Sequence 1:NP_725192.2 Gene:Galphaq / 36384 FlyBaseID:FBgn0004435 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_524118.1 Gene:Galphaf / 39861 FlyBaseID:FBgn0010223 Length:399 Species:Drosophila melanogaster


Alignment Length:407 Identity:140/407 - (34%)
Similarity:216/407 - (53%) Gaps:65/407 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 INQEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGYIKLVFQNIFM 79
            ::..:.|.:.:..||.  .:|:|||||.||||:|.||||||:|.:|::|:::|..|..::|||..
  Fly    31 LDHHVLKDMAKGVRDT--TVKILLLGTAESGKTTIIKQMRILHINGFTDDERREKIPEIYQNIHE 93

  Fly    80 AMQSMIKAMDMLKISYGQGEHSELADLVMSIDYETVTTFEDPYLNAIKTLWDDAGIQECYDRRRE 144
            ::..::..|.:|.|.:|.......||.::|:.........:.|.:.:.|||:|.||:.||||..|
  Fly    94 SILQLVGQMGVLGIDFGSCTSERSADYILSLPGSAPEYMNEEYCDHVTTLWNDVGIRACYDRSNE 158

  Fly   145 YQLTDSAKYYLKDLDRVAQPAYLPTEQDILRVRVPTTGIIEYPFDLEEIRFSYLSDLARIEQADY 209
            :.|.|||||:|.:..|::...|:|:.:|||..|..||||.:..|                     
  Fly   159 FPLLDSAKYFLDNFVRISDAEYIPSTEDILHSRKITTGISQITF--------------------- 202

  Fly   210 LPTEQDILRARVPTTGILEYPFDLDG--IVFRMVDVGGQRSERRKWIHCFENVTSIIFLVALSEY 272
                      |||      .|..:.|  ..|:|.||||||.:|.|||..||.:.:::||::.||:
  Fly   203 ----------RVP------IPKSMGGGEQQFQMYDVGGQRDQRNKWIQVFEGIQAVLFLISCSEF 251

  Fly   273 DQILFESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMY-SHLVDYFPEYDG-- 334
            ||.|.|..::||::|:..|||.:....:..::.:|:||||.|::|.||.. .|:|||||||:.  
  Fly   252 DQNLREDPSQNRLQEALKLFRAVWQNRFLASAGLIVFLNKYDIMERKIRAGKHIVDYFPEYEDFC 316

  Fly   335 --PQRD-----AITAREFILRMFVDLNPD--------------SEKIIYSHFTCATDTENIKLVF 378
              ||:|     :...:.||.:..||:..:              ||:..|.|||.||||..|:.||
  Fly   317 KRPQQDNCFGESDWTKMFIKQKLVDITQEPFKRHSRNQVDLGTSERECYYHFTVATDTRCIRDVF 381

  Fly   379 CAVKDTIMQNALKEFNL 395
            |.|:..|:...:....|
  Fly   382 CDVQKMILSENVSSMGL 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaqNP_725192.2 G-alpha 34..390 CDD:206639 136/381 (36%)
GalphafNP_524118.1 G_alpha 30..397 CDD:214595 139/404 (34%)
G-alpha 48..392 CDD:206639 136/380 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455814
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10218
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.