DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaq and gnai2

DIOPT Version :9

Sequence 1:NP_725192.2 Gene:Galphaq / 36384 FlyBaseID:FBgn0004435 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_989250.1 Gene:gnai2 / 394861 XenbaseID:XB-GENE-6050844 Length:355 Species:Xenopus tropicalis


Alignment Length:399 Identity:184/399 - (46%)
Similarity:231/399 - (57%) Gaps:49/399 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MECCLSEEAKEQKRINQEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDED 65
            |.|.:|.|.|.....::.|:|.||.|...|.||:||||||.|||||||.:|||:|||..|||:|:
 Frog     1 MGCTVSAEDKAAAERSKNIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDGYSEEE 65

  Fly    66 KRGYIKLVFQNIFMAMQSMIKAMDMLKISYGQGEHSELAD--LVMSIDYETVTTFEDPYLNAIKT 128
            .|.|..:||.|...::.::||||..|||.:|....::.|.  ..:|...|......|.....|:.
 Frog    66 CRQYRAVVFSNTIQSIMAIIKAMGNLKIDFGDPARADDARQLFALSSTAEEQGILPDDLAGVIRR 130

  Fly   129 LWDDAGIQECYDRRREYQLTDSAKYYLKDLDRVAQPAYLPTEQDILRVRVPTTGIIEYPFDLEEI 193
            ||.|.|:|.|:.|.|||||.|||.|||.||:|:|                               
 Frog   131 LWADPGVQACFSRSREYQLNDSAAYYLNDLERIA------------------------------- 164

  Fly   194 RFSYLSDLARIEQADYLPTEQDILRARVPTTGILEYPFDLDGIVFRMVDVGGQRSERRKWIHCFE 258
                        ::||:||:||:||.||.||||:|..|....:.|:|.|||||||||:|||||||
 Frog   165 ------------RSDYVPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFE 217

  Fly   259 NVTSIIFLVALSEYDQILFESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYS 323
            .||:|||.||||.||.:|.|.:..|||.||..||.:|....||..:|:|||||||||.||||..|
 Frog   218 GVTAIIFCVALSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKITRS 282

  Fly   324 HLVDYFPEYDGP-QRDAITAREFILRMFVDLNPDSE-KIIYSHFTCATDTENIKLVFCAVKDTIM 386
            .|...||||.|. |.|  .|..:|...|.|||...: |.||:||||||||:|::.||.||.|.|:
 Frog   283 PLSICFPEYSGANQYD--EAASYIQTKFEDLNKRRDTKEIYTHFTCATDTKNVQFVFDAVTDVII 345

  Fly   387 QNALKEFNL 395
            :|.||:..|
 Frog   346 KNNLKDCGL 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaqNP_725192.2 G-alpha 34..390 CDD:206639 168/359 (47%)
gnai2NP_989250.1 G-alpha 34..349 CDD:206639 168/359 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.