DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaq and gna11

DIOPT Version :9

Sequence 1:NP_725192.2 Gene:Galphaq / 36384 FlyBaseID:FBgn0004435 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_989150.1 Gene:gna11 / 394755 XenbaseID:XB-GENE-944497 Length:359 Species:Xenopus tropicalis


Alignment Length:395 Identity:292/395 - (73%)
Similarity:320/395 - (81%) Gaps:43/395 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MECCLSEEAKEQKRINQEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDED 65
            |.||||||.||.||||.||||||||||:|:||||||||||||||||||||||||||||||||:||
 Frog     7 MACCLSEEVKESKRINAEIEKQLRRDKKDSRRELKLLLLGTGESGKSTFIKQMRIIHGSGYSEED 71

  Fly    66 KRGYIKLVFQNIFMAMQSMIKAMDMLKISYGQGEHSELADLVMSIDYETVTTFEDPYLNAIKTLW 130
            |||:.||||||||.||||||:|||.|||.|...::...|.:|..:|.|.|.|||.||:||||.||
 Frog    72 KRGFTKLVFQNIFTAMQSMIRAMDTLKIPYKCEQNKANAQVVREVDVEKVCTFEQPYVNAIKNLW 136

  Fly   131 DDAGIQECYDRRREYQLTDSAKYYLKDLDRVAQPAYLPTEQDILRVRVPTTGIIEYPFDLEEIRF 195
            .|.||||||||||||||:|||||||.|:||:::|.||||:||:||||||||||||||||||    
 Frog   137 SDPGIQECYDRRREYQLSDSAKYYLTDVDRISKPGYLPTQQDVLRVRVPTTGIIEYPFDLE---- 197

  Fly   196 SYLSDLARIEQADYLPTEQDILRARVPTTGILEYPFDLDGIVFRMVDVGGQRSERRKWIHCFENV 260
                                                   .|:|||||||||||||||||||||||
 Frog   198 ---------------------------------------NIIFRMVDVGGQRSERRKWIHCFENV 223

  Fly   261 TSIIFLVALSEYDQILFESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHL 325
            |||:||||||||||:|.||||||||||||||||||||||||||||||||||||||||:|||||||
 Frog   224 TSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEDKIMYSHL 288

  Fly   326 VDYFPEYDGPQRDAITAREFILRMFVDLNPDSEKIIYSHFTCATDTENIKLVFCAVKDTIMQNAL 390
            ||||||:|||||||.|||||||:|||||||||:||||||||||||||||:.||.||||||:|:.|
 Frog   289 VDYFPEFDGPQRDAATAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQHNL 353

  Fly   391 KEFNL 395
            ||:||
 Frog   354 KEYNL 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaqNP_725192.2 G-alpha 34..390 CDD:206639 260/355 (73%)
gna11NP_989150.1 G-alpha 40..353 CDD:206639 260/355 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 532 1.000 Domainoid score I284
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 564 1.000 Inparanoid score I1071
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 1 1.000 - - otm48526
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.050

Return to query results.
Submit another query.