DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaq and gnai1

DIOPT Version :9

Sequence 1:NP_725192.2 Gene:Galphaq / 36384 FlyBaseID:FBgn0004435 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_957265.1 Gene:gnai1 / 393946 ZFINID:ZDB-GENE-040426-1310 Length:354 Species:Danio rerio


Alignment Length:401 Identity:178/401 - (44%)
Similarity:236/401 - (58%) Gaps:54/401 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MECCLSEEAKEQKRINQEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDED 65
            |.|.||.|.|.....::.|::.||.|...|.||:||||||.|||||||.:|||:|||.:|||:|:
Zfish     1 MGCTLSTEDKAAVERSKMIDRNLRDDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEE 65

  Fly    66 KRGYIKLVFQNIFMAMQSMIKAMDMLKISYGQGEHSELADLVMSIDYETVTTFEDPYLNA----- 125
            .:.|..:|:.|...::.::|:||..|||.:|....::.|..:    :....:.|:.::.|     
Zfish    66 CKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDAARADDARQL----FVLAGSAEEGFMTAELAGV 126

  Fly   126 IKTLWDDAGIQECYDRRREYQLTDSAKYYLKDLDRVAQPAYLPTEQDILRVRVPTTGIIEYPFDL 190
            ||.||.|.|:|.|:.|.|||||.|||.|||.||||::|..|:||:||:||.||.||||:|..|..
Zfish   127 IKRLWKDGGVQACFSRSREYQLNDSAAYYLNDLDRISQATYIPTQQDVLRTRVKTTGIVETHFTF 191

  Fly   191 EEIRFSYLSDLARIEQADYLPTEQDILRARVPTTGILEYPFDLDGIVFRMVDVGGQRSERRKWIH 255
            :::.                                           |:|.|||||||||:||||
Zfish   192 KDLH-------------------------------------------FKMFDVGGQRSERKKWIH 213

  Fly   256 CFENVTSIIFLVALSEYDQILFESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKI 320
            |||.||:|||.||||:||.:|.|.:..|||.||..||.:|....||.::|:|||||||||.||||
Zfish   214 CFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKI 278

  Fly   321 MYSHLVDYFPEYDGPQRDAITAREFILRMFVDLNPDSE-KIIYSHFTCATDTENIKLVFCAVKDT 384
            ..|.|...:|||.| ......|..:|...|.|||...: |.||:||||||||:|::.||.||.|.
Zfish   279 RKSTLTICYPEYAG-SNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDV 342

  Fly   385 IMQNALKEFNL 395
            |::|.||:..|
Zfish   343 IIKNNLKDCGL 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaqNP_725192.2 G-alpha 34..390 CDD:206639 162/361 (45%)
gnai1NP_957265.1 G_alpha 14..352 CDD:214595 171/385 (44%)
G-alpha 34..348 CDD:206639 162/361 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.