DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaq and gnao1a

DIOPT Version :9

Sequence 1:NP_725192.2 Gene:Galphaq / 36384 FlyBaseID:FBgn0004435 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_957081.1 Gene:gnao1a / 393760 ZFINID:ZDB-GENE-040426-1757 Length:354 Species:Danio rerio


Alignment Length:399 Identity:181/399 - (45%)
Similarity:229/399 - (57%) Gaps:58/399 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MECCLSEEAKEQKRINQEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDED 65
            |.|.||.|.:.....::.|||.|:.|...|.:::||||||.|||||||.:|||:|||..|:|.:|
Zfish     1 MGCTLSAEERAALDRSKAIEKNLKEDGITAAKDVKLLLLGAGESGKSTIVKQMKIIHEDGFSGDD 65

  Fly    66 KRGYIKLVFQNIFMAMQSMIKAMDMLKISYGQGEHSELADLVMSIDYETVTTFED--PY----LN 124
            .:.|..:|:.|...::.::::|||.|.:.||..|....|.:|..:    |:..||  ||    |:
Zfish    66 VKQYKPVVYSNTIQSLAAIVRAMDTLGLEYGDKERKADAKMVCDV----VSRMEDTEPYSPELLS 126

  Fly   125 AIKTLWDDAGIQECYDRRREYQLTDSAKYYLKDLDRVAQPAYLPTEQDILRVRVPTTGIIEYPFD 189
            |:..||.|:|||||:.|.|||||.|||:|||..|||:.                           
Zfish   127 AMIRLWSDSGIQECFSRAREYQLNDSAQYYLDSLDRIG--------------------------- 164

  Fly   190 LEEIRFSYLSDLARIEQADYLPTEQDILRARVPTTGILEYPFDLDGIVFRMVDVGGQRSERRKWI 254
                            .|||.||||||||.||.||||:|..|....:.||:.|||||||||:|||
Zfish   165 ----------------AADYQPTEQDILRTRVKTTGIVETHFTFKNLHFRLFDVGGQRSERKKWI 213

  Fly   255 HCFENVTSIIFLVALSEYDQILFESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEK 319
            ||||:||:|||.||||.|||:|.|.:..|||.||..||.:|....:|.::|:|||||||||..||
Zfish   214 HCFEDVTAIIFCVALSGYDQVLHEDETTNRMHESLMLFDSICNNKFFIDTSIILFLNKKDLFAEK 278

  Fly   320 IMYSHLVDYFPEYDGPQR--DAITAREFILRMFVDLNPDSEKIIYSHFTCATDTENIKLVFCAVK 382
            |..|.|...||||.||..  ||..   :|...|...|....|.||.|.||||||.||::||.||.
Zfish   279 IKKSPLSICFPEYTGPNTYDDAAA---YIQAQFESKNRSPNKEIYCHMTCATDTGNIQVVFDAVT 340

  Fly   383 DTIMQNALK 391
            |.|:.|.|:
Zfish   341 DIIIANNLR 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaqNP_725192.2 G-alpha 34..390 CDD:206639 169/363 (47%)
gnao1aNP_957081.1 G-alpha 34..348 CDD:206639 169/363 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.