DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaq and Galphas

DIOPT Version :9

Sequence 1:NP_725192.2 Gene:Galphaq / 36384 FlyBaseID:FBgn0004435 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001163283.1 Gene:Galphas / 37805 FlyBaseID:FBgn0001123 Length:385 Species:Drosophila melanogaster


Alignment Length:416 Identity:159/416 - (38%)
Similarity:221/416 - (53%) Gaps:73/416 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SEEAKEQKRINQEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGYI 70
            ||::|.|||.:..|.:||::||:..|...:|||||.|||||||.:|||||:|..|:||.:|:..|
  Fly    16 SEDSKSQKRRSDAISRQLQKDKQLYRATHRLLLLGAGESGKSTIVKQMRILHVDGFSDSEKKQKI 80

  Fly    71 KLVFQNIFMAMQSMIKAMDMLK--ISYGQGEHSELADLVMSIDYETVTTFEDP--YLNAIKTLWD 131
            ..:.:||..|:.::..||..|.  ::..:.|:....:.:.  ||.:...|..|  :....:.||.
  Fly    81 DDIKKNIRDAILTITGAMSTLNPPVALEKKENEPRVEYIQ--DYASSPDFNYPPEFYEHTEELWK 143

  Fly   132 DAGIQECYDRRREYQLTDSAKYYLKDLDRVAQPAYLPTEQDILRVRVPTTGIIEYPFDLEEIRFS 196
            |.|:.:.|:|..||||.|.|||:   ||||                                   
  Fly   144 DKGVLQTYERSNEYQLIDCAKYF---LDRV----------------------------------- 170

  Fly   197 YLSDLARIEQADYLPTEQDILRARVPTTGILEYPFDLDGIVFRMVDVGGQRSERRKWIHCFENVT 261
                 :.|:..:|.|.||||||.||.|:||.|..|.:|.:.|.|.||||||.||||||.||.:||
  Fly   171 -----STIKNPNYTPNEQDILRCRVLTSGIFETRFQVDKVNFHMFDVGGQRDERRKWIQCFNDVT 230

  Fly   262 SIIFLVALSEYDQILFESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIM--YSH 324
            :|||:.|.|.|:.:|.|...:||:.||..||::|....|.:..|:||||||:|||.|||.  .|.
  Fly   231 AIIFVTACSSYNMVLREDPTQNRLRESLDLFKSIWNNRWLRTISIILFLNKQDLLAEKIKAGKSK 295

  Fly   325 LVDYFPEY-----------------DGPQRDAITAREFILRMFVDLNP---DSEKIIYSHFTCAT 369
            |.:||.|:                 |.|  :.|.|:.||...|:.::.   |.:...|.|||||.
  Fly   296 LSEYFSEFNKYQTPIDTGDAIMESNDDP--EVIRAKYFIRDEFLRISTASGDGKHYCYPHFTCAV 358

  Fly   370 DTENIKLVFCAVKDTIMQNALKEFNL 395
            ||||||.||...:|.|.:..|:::.|
  Fly   359 DTENIKRVFNDCRDIIQRMHLRQYEL 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaqNP_725192.2 G-alpha 34..390 CDD:206639 145/381 (38%)
GalphasNP_001163283.1 G-alpha 44..379 CDD:206639 145/381 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455810
Domainoid 1 1.000 229 1.000 Domainoid score I660
eggNOG 1 0.900 - - E1_KOG0082
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 233 1.000 Inparanoid score I1124
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3584
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10218
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.