DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaq and Gnat2

DIOPT Version :9

Sequence 1:NP_725192.2 Gene:Galphaq / 36384 FlyBaseID:FBgn0004435 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001102420.2 Gene:Gnat2 / 365901 RGDID:1309514 Length:354 Species:Rattus norvegicus


Alignment Length:393 Identity:171/393 - (43%)
Similarity:225/393 - (57%) Gaps:46/393 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LSEEAKEQKRINQEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGY 69
            :|.|.||..:.::|:||:|:.|.....:.:||||||.|||||||.:|||:|||..|||.|:...:
  Rat     5 ISAEDKELAKRSRELEKKLQEDADKEAKTVKLLLLGAGESGKSTIVKQMKIIHQDGYSPEECLEF 69

  Fly    70 IKLVFQNIFMAMQSMIKAMDMLKISYGQGEHSELADLVMSI-DYETVTTFEDPYLNAIKTLWDDA 133
            ..:::.|:..::.::|:||..|.|.|.:...:|....:.:: |.....|.....:..|:.||.|.
  Rat    70 KSVIYGNVLQSILAIIRAMSTLGIDYAEPSCAEAGRQLNNLADSTEEGTMPSELVEVIRKLWKDG 134

  Fly   134 GIQECYDRRREYQLTDSAKYYLKDLDRVAQPAYLPTEQDILRVRVPTTGIIEYPFDLEEIRFSYL 198
            |:|.|:||..|:||.|||.|||..|||:..|                                  
  Rat   135 GVQACFDRAAEFQLNDSASYYLNQLDRITDP---------------------------------- 165

  Fly   199 SDLARIEQADYLPTEQDILRARVPTTGILEYPFDLDGIVFRMVDVGGQRSERRKWIHCFENVTSI 263
                     ||||.|||:||:||.||||:|..|.:..:.|||.|||||||||:|||||||.||.|
  Rat   166 ---------DYLPNEQDVLRSRVKTTGIIETKFSVKDLNFRMFDVGGQRSERKKWIHCFEGVTCI 221

  Fly   264 IFLVALSEYDQILFESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDY 328
            ||..|||.||.:|.|.|..|||.||..||.:|..:.:|..:|::||||||||.||||...||...
  Rat   222 IFCAALSAYDMVLVEDDEVNRMHESLHLFNSICNHKFFAATSIVLFLNKKDLFEEKIKKVHLSIC 286

  Fly   329 FPEYDGPQRDAITAREFILRMFVDLNPDSE-KIIYSHFTCATDTENIKLVFCAVKDTIMQNALKE 392
            |||||| ......|..:|...|:|||...: |.||||.||||||:|:|.||.||.|.|::..||:
  Rat   287 FPEYDG-NNSYEDAGNYIKSQFLDLNMRKDVKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKD 350

  Fly   393 FNL 395
            ..|
  Rat   351 CGL 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaqNP_725192.2 G-alpha 34..390 CDD:206639 159/357 (45%)
Gnat2NP_001102420.2 G-alpha 34..348 CDD:206639 159/357 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X53
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.