DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaq and cta

DIOPT Version :9

Sequence 1:NP_725192.2 Gene:Galphaq / 36384 FlyBaseID:FBgn0004435 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001036421.1 Gene:cta / 3355131 FlyBaseID:FBgn0000384 Length:457 Species:Drosophila melanogaster


Alignment Length:408 Identity:159/408 - (38%)
Similarity:226/408 - (55%) Gaps:64/408 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CC-----------LSEEAKEQKRINQEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRII 56
            ||           .:.|..||:..::||:|.|.::|...||::||||||.||||||||:||||||
  Fly    91 CCGNIITYLVRLRSTPEELEQRYKSKEIDKFLEKEKHTFRRQVKLLLLGAGESGKSTFLKQMRII 155

  Fly    57 HGSGYSDEDKRGYIKLVFQNIFMAMQSMIKAMDMLKISYG-QGEHSELADL-VMSIDYETVTTFE 119
            ||..:..|....|..:::||:...||.::.|.:.|.|::| .|...:..|. :|..:...|..|.
  Fly   156 HGVNFDYELLLEYQSVIYQNVIRGMQVLLDAREKLNIAWGSDGREQDAYDAKLMECNSLDVPKFM 220

  Fly   120 DPYLNAIKTLWDDAGIQECYDRRREYQLTDSAKYYLKDLDRVAQPAYLPTEQDILRVRVPTTGII 184
            : |...|..||.|.||:..::||||:|::||..|:|.::.|:|.|                    
  Fly   221 E-YAPPISRLWQDRGIRRAFERRREFQISDSVSYFLDEIQRLATP-------------------- 264

  Fly   185 EYPFDLEEIRFSYLSDLARIEQADYLPTEQDILRARVPTTGILEYPFDLDGIVFRMVDVGGQRSE 249
                                   ||:||.:|||..|..|.|:.|:...:..|.|..|||||||::
  Fly   265 -----------------------DYVPTHKDILHCRKATKGVYEFCVKVQNIPFVFVDVGGQRTQ 306

  Fly   250 RRKWIHCFE-NVTSIIFLVALSEYDQILFESDNENRMEESKALFRTIITYPWFQNSSVILFLNKK 313
            |:||..||: :||||||||:.||:||:|.|....||:||||.:|.||:....|:..|:||||||.
  Fly   307 RQKWTRCFDSSVTSIIFLVSSSEFDQVLAEDRKTNRLEESKNIFDTIVNNATFKGISIILFLNKT 371

  Fly   314 DLLEEKIM--YSHLVDYFPEYDGPQRDAITAREFILRMFVDLNPDSE-KIIYSHFTCATDTENIK 375
            ||||:|:.  .:.:..|:|.::|.....:..:.|||:||:.:...|. ..||.|||.|.||.||.
  Fly   372 DLLEQKVCNPETDIRWYYPHFNGNPHSVLDVQNFILQMFMSVRRSSSISRIYHHFTTAIDTRNIN 436

  Fly   376 LVFCAVKDTIMQ---NAL 390
            :||.:|||||:|   |||
  Fly   437 VVFNSVKDTILQRNLNAL 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaqNP_725192.2 G-alpha 34..390 CDD:206639 145/364 (40%)
ctaNP_001036421.1 G_alpha 112..455 CDD:214595 154/387 (40%)
G-alpha 133..451 CDD:206639 144/361 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455807
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10218
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
54.840

Return to query results.
Submit another query.