DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaq and gnaia

DIOPT Version :9

Sequence 1:NP_725192.2 Gene:Galphaq / 36384 FlyBaseID:FBgn0004435 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_942100.1 Gene:gnaia / 323509 ZFINID:ZDB-GENE-030131-2229 Length:377 Species:Danio rerio


Alignment Length:401 Identity:178/401 - (44%)
Similarity:237/401 - (59%) Gaps:54/401 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MECCLSEEAKEQKRINQEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDED 65
            |.|.||.:.|..:..::.|::.||.|...|.||:||||||.|||||||.:|||:|||.:|||:|:
Zfish    24 MGCTLSSDDKSAQERSKMIDRNLRDDGEKASREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEE 88

  Fly    66 KRGYIKLVFQNIFMAMQSMIKAMDMLKISYGQGEHS----ELADLVMSIDYETVTTFEDPYLNAI 126
            .:.|..:|:.|...::.::|:||..|:|.:...|.:    :|..:..|:|...:|:   .....|
Zfish    89 CKQYRVVVYSNTIQSIIAIIRAMGRLRIDFADPERADDARQLFVMAGSVDEGFMTS---ELAGVI 150

  Fly   127 KTLWDDAGIQECYDRRREYQLTDSAKYYLKDLDRVAQPAYLPTEQDILRVRVPTTGIIEYPFDLE 191
            |.||.|.|::.|:.|.|||||.|||.|||.||||::..:|:||:||:||.||.||||:|..|..:
Zfish   151 KRLWRDEGVRLCFHRSREYQLNDSASYYLNDLDRISNSSYVPTQQDVLRTRVKTTGIVETHFTFK 215

  Fly   192 EIRFSYLSDLARIEQADYLPTEQDILRARVPTTGILEYPFDLDGIVFRMVDVGGQRSERRKWIHC 256
            ::.                                           |:|.|||||||||:|||||
Zfish   216 DLH-------------------------------------------FKMFDVGGQRSERKKWIHC 237

  Fly   257 FENVTSIIFLVALSEYDQILFESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIM 321
            ||.||||||.|:||:||.:|.|.:..|||.||..||.:|....||.::|:|||||||||.||||.
Zfish   238 FEGVTSIIFCVSLSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIR 302

  Fly   322 YSHLVDYFPEYDGPQRDAI-TAREFILRMFVDLNPDSE-KIIYSHFTCATDTENIKLVFCAVKDT 384
            .|.|...||||  |..|.. .|..:|...|.|||...: |.|||||||||||:|::.||.||.|.
Zfish   303 MSPLSICFPEY--PGSDVYEEAAAYIQCQFEDLNKRKDTKEIYSHFTCATDTKNVQFVFDAVTDV 365

  Fly   385 IMQNALKEFNL 395
            |::|.||:..|
Zfish   366 IIKNNLKDCGL 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaqNP_725192.2 G-alpha 34..390 CDD:206639 163/361 (45%)
gnaiaNP_942100.1 G_alpha 37..375 CDD:214595 172/385 (45%)
G-alpha 57..371 CDD:206639 163/361 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.