DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaq and Gna14

DIOPT Version :9

Sequence 1:NP_725192.2 Gene:Galphaq / 36384 FlyBaseID:FBgn0004435 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001013169.1 Gene:Gna14 / 309242 RGDID:1308122 Length:355 Species:Rattus norvegicus


Alignment Length:393 Identity:261/393 - (66%)
Similarity:304/393 - (77%) Gaps:43/393 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CCLSEEAKEQKRINQEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKR 67
            ||||.|.||.:||:.|||:||||||:|||||||||||||||||||||||||||||||||||||::
  Rat     5 CCLSAEEKESQRISAEIERQLRRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDRK 69

  Fly    68 GYIKLVFQNIFMAMQSMIKAMDMLKISYGQGEHSELADLVMSIDYETVTTFEDPYLNAIKTLWDD 132
            |:.|||:||||.|||:||:|||.|:|.|...::.|.|.::..::.:.|:......:.|||.||.|
  Rat    70 GFTKLVYQNIFTAMQAMIRAMDTLRIQYTCEQNKENAQIIREVEVDKVSAISRDQVAAIKQLWLD 134

  Fly   133 AGIQECYDRRREYQLTDSAKYYLKDLDRVAQPAYLPTEQDILRVRVPTTGIIEYPFDLEEIRFSY 197
            .||||||||||||||:|||||||.|:||:|.|:::||:||:||||||||||||||||||      
  Rat   135 PGIQECYDRRREYQLSDSAKYYLTDIDRIAMPSFVPTQQDVLRVRVPTTGIIEYPFDLE------ 193

  Fly   198 LSDLARIEQADYLPTEQDILRARVPTTGILEYPFDLDGIVFRMVDVGGQRSERRKWIHCFENVTS 262
                                                 .|:|||||||||||||||||||||:|||
  Rat   194 -------------------------------------NIIFRMVDVGGQRSERRKWIHCFESVTS 221

  Fly   263 IIFLVALSEYDQILFESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVD 327
            ||||||||||||:|.|.|||||||||||||:||||||||.|||||||||||||||||||||||:.
  Rat   222 IIFLVALSEYDQVLAECDNENRMEESKALFKTIITYPWFLNSSVILFLNKKDLLEEKIMYSHLIS 286

  Fly   328 YFPEYDGPQRDAITAREFILRMFVDLNPDSEKIIYSHFTCATDTENIKLVFCAVKDTIMQNALKE 392
            |||||.||::|...||:|||:::.|.|||.||:||||||||||||||:.||.||||||:|..|:|
  Rat   287 YFPEYTGPKQDVKAARDFILKLYQDQNPDKEKVIYSHFTCATDTENIRFVFAAVKDTILQLNLRE 351

  Fly   393 FNL 395
            |||
  Rat   352 FNL 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaqNP_725192.2 G-alpha 34..390 CDD:206639 233/355 (66%)
Gna14NP_001013169.1 G_alpha 16..353 CDD:214595 251/379 (66%)
G-alpha 36..349 CDD:206639 233/355 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 530 1.000 Domainoid score I275
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 562 1.000 Inparanoid score I1047
OMA 1 1.010 - - QHG54330
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 1 1.000 - - otm45451
orthoMCL 1 0.900 - - OOG6_104168
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X53
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.770

Return to query results.
Submit another query.