DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaq and GNA12

DIOPT Version :9

Sequence 1:NP_725192.2 Gene:Galphaq / 36384 FlyBaseID:FBgn0004435 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_031379.2 Gene:GNA12 / 2768 HGNCID:4380 Length:381 Species:Homo sapiens


Alignment Length:414 Identity:152/414 - (36%)
Similarity:224/414 - (54%) Gaps:65/414 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CCLSEEA----------------KEQKRINQEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIK 51
            |.|..||                :|.:|.:::|:..|.|::|..||.:|:||||.||||||||:|
Human    11 CLLPAEAGGARERRAGSGARDAEREARRRSRDIDALLARERRAVRRLVKILLLGAGESGKSTFLK 75

  Fly    52 QMRIIHGSGYSDEDKRGYIKLVFQNIFMAMQSMIKAMDMLKISYGQGEHSELADLVMSIDYET-- 114
            |||||||..:..:....:...:|.||....:.::.|.|.|.|.:...|:.:....:|:.:.:.  
Human    76 QMRIIHGREFDQKALLEFRDTIFDNILKGSRVLVDARDKLGIPWQYSENEKHGMFLMAFENKAGL 140

  Fly   115 ---VTTFEDPYLNAIKTLWDDAGIQECYDRRREYQLTDSAKYYLKDLDRVAQPAYLPTEQDILRV 176
               ..||: .|:.|:..||.|:||:|.:.||.|:||.:|.||:|.:|||:.              
Human   141 PVEPATFQ-LYVPALSALWRDSGIREAFSRRSEFQLGESVKYFLDNLDRIG-------------- 190

  Fly   177 RVPTTGIIEYPFDLEEIRFSYLSDLARIEQADYLPTEQDILRARVPTTGILEYPFDLDGIVFRMV 241
                                         |.:|.|::||||.||..|.||:|:.|.:..|.|:||
Human   191 -----------------------------QLNYFPSKQDILLARKATKGIVEHDFVIKKIPFKMV 226

  Fly   242 DVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFESDNENRMEESKALFRTIITYPWFQNSSV 306
            |||||||:|:||..||:.:|||:|:|:.|||||:|.|....||:.||..:|.||:....|.|.|:
Human   227 DVGGQRSQRQKWFQCFDGITSILFMVSSSEYDQVLMEDRRTNRLVESMNIFETIVNNKLFFNVSI 291

  Fly   307 ILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAITAREFILRMFVDLNPDSEKIIYSHFTCATDT 371
            ||||||.|||.||:....:..:||::.|........:.::::.|.....:..|.::.|||.|.||
Human   292 ILFLNKMDLLVEKVKTVSIKKHFPDFRGDPHRLEDVQRYLVQCFDRKRRNRSKPLFHHFTTAIDT 356

  Fly   372 ENIKLVFCAVKDTIMQNALKEFNL 395
            ||::.||.||||||:|..||:..|
Human   357 ENVRFVFHAVKDTILQENLKDIML 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaqNP_725192.2 G-alpha 34..390 CDD:206639 137/360 (38%)
GNA12NP_031379.2 G_alpha 42..379 CDD:214595 145/380 (38%)
G1 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 59..72 10/12 (83%)
G2 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 200..208 5/7 (71%)
G3 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 223..232 7/8 (88%)
G4 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 292..299 6/6 (100%)
G5 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 351..356 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.