DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaq and GNA11

DIOPT Version :9

Sequence 1:NP_725192.2 Gene:Galphaq / 36384 FlyBaseID:FBgn0004435 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_002058.2 Gene:GNA11 / 2767 HGNCID:4379 Length:359 Species:Homo sapiens


Alignment Length:395 Identity:287/395 - (72%)
Similarity:318/395 - (80%) Gaps:43/395 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MECCLSEEAKEQKRINQEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDED 65
            |.||||:|.||.||||.|||||||||||||||||||||||||||||||||||||||||:|||:||
Human     7 MACCLSDEVKESKRINAEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGAGYSEED 71

  Fly    66 KRGYIKLVFQNIFMAMQSMIKAMDMLKISYGQGEHSELADLVMSIDYETVTTFEDPYLNAIKTLW 130
            |||:.|||:||||.|||:||:||:.|||.|...::...|.|:..:|.|.|||||..|::||||||
Human    72 KRGFTKLVYQNIFTAMQAMIRAMETLKILYKYEQNKANALLIREVDVEKVTTFEHQYVSAIKTLW 136

  Fly   131 DDAGIQECYDRRREYQLTDSAKYYLKDLDRVAQPAYLPTEQDILRVRVPTTGIIEYPFDLEEIRF 195
            :|.||||||||||||||:|||||||.|:||:|...||||:||:||||||||||||||||||    
Human   137 EDPGIQECYDRRREYQLSDSAKYYLTDVDRIATLGYLPTQQDVLRVRVPTTGIIEYPFDLE---- 197

  Fly   196 SYLSDLARIEQADYLPTEQDILRARVPTTGILEYPFDLDGIVFRMVDVGGQRSERRKWIHCFENV 260
                                                   .|:|||||||||||||||||||||||
Human   198 ---------------------------------------NIIFRMVDVGGQRSERRKWIHCFENV 223

  Fly   261 TSIIFLVALSEYDQILFESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHL 325
            |||:||||||||||:|.||||||||||||||||||||||||||||||||||||||||:||:||||
Human   224 TSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEDKILYSHL 288

  Fly   326 VDYFPEYDGPQRDAITAREFILRMFVDLNPDSEKIIYSHFTCATDTENIKLVFCAVKDTIMQNAL 390
            ||||||:|||||||..||||||:|||||||||:||||||||||||||||:.||.||||||:|..|
Human   289 VDYFPEFDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNL 353

  Fly   391 KEFNL 395
            ||:||
Human   354 KEYNL 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaqNP_725192.2 G-alpha 34..390 CDD:206639 254/355 (72%)
GNA11NP_002058.2 G-alpha 40..353 CDD:206639 254/355 (72%)
G1 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 41..54 12/12 (100%)
G2 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 178..186 6/7 (86%)
G3 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 201..210 8/8 (100%)
G4 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 270..277 6/6 (100%)
G5 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 329..334 4/4 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 530 1.000 Domainoid score I283
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 562 1.000 Inparanoid score I1089
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 1 1.000 - - otm41322
orthoMCL 1 0.900 - - OOG6_104168
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.730

Return to query results.
Submit another query.