DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaq and CG30054

DIOPT Version :9

Sequence 1:NP_725192.2 Gene:Galphaq / 36384 FlyBaseID:FBgn0004435 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001036538.3 Gene:CG30054 / 246420 FlyBaseID:FBgn0050054 Length:353 Species:Drosophila melanogaster


Alignment Length:395 Identity:280/395 - (70%)
Similarity:310/395 - (78%) Gaps:43/395 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MECCLSEEAKEQKRINQEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDED 65
            |.||.|.||.|::|||:||:||||.:|:.::|||||||||..|||||||||||||||||||||||
  Fly     1 MHCCSSTEAMEKRRINEEIDKQLRLEKKRSKRELKLLLLGACESGKSTFIKQMRIIHGSGYSDED 65

  Fly    66 KRGYIKLVFQNIFMAMQSMIKAMDMLKISYGQGEHSELADLVMSIDYETVTTFEDPYLNAIKTLW 130
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly    66 KRGYIKLVFQNIFMAMQSMIKAMDMLKISYGQGEHSELADLVMSIDYETVTTFEDPYLNAIKTLW 130

  Fly   131 DDAGIQECYDRRREYQLTDSAKYYLKDLDRVAQPAYLPTEQDILRVRVPTTGIIEYPFDLEEIRF 195
            .|||||||||||||||||||.:|                                          
  Fly   131 HDAGIQECYDRRREYQLTDSTEY------------------------------------------ 153

  Fly   196 SYLSDLARIEQADYLPTEQDILRARVPTTGILEYPFDLDGIVFRMVDVGGQRSERRKWIHCFENV 260
             :|.|:.||||||||||.|||||||.||..|..|||:|||.|..||||.|||:|||||||.|.||
  Fly   154 -FLGDIGRIEQADYLPTNQDILRAREPTFNITVYPFELDGYVLSMVDVAGQRTERRKWIHFFSNV 217

  Fly   261 TSIIFLVALSEYDQILFESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHL 325
            ||||||.|||||||.:.||:|:||:|||||||.||||:.||:|:|:||||||.|:||||||||||
  Fly   218 TSIIFLAALSEYDQFMMESENDNRLEESKALFHTIITFEWFKNASIILFLNKMDVLEEKIMYSHL 282

  Fly   326 VDYFPEYDGPQRDAITAREFILRMFVDLNPDSEKIIYSHFTCATDTENIKLVFCAVKDTIMQNAL 390
            ||||||||||::||..|||::||||..::.|:.|.|||||||||||||||.||.||||||:|..|
  Fly   283 VDYFPEYDGPKQDAYAAREYVLRMFQSISLDTYKKIYSHFTCATDTENIKFVFAAVKDTILQCNL 347

  Fly   391 KEFNL 395
            ||.||
  Fly   348 KESNL 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaqNP_725192.2 G-alpha 34..390 CDD:206639 256/355 (72%)
CG30054NP_001036538.3 G_alpha 13..351 CDD:214595 271/380 (71%)
G-alpha 34..347 CDD:206639 256/355 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455802
Domainoid 1 1.000 229 1.000 Domainoid score I660
eggNOG 1 0.900 - - E1_KOG0082
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 233 1.000 Inparanoid score I1124
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 1 1.000 - - mtm6605
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10218
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
87.980

Return to query results.
Submit another query.