DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaq and Gnal

DIOPT Version :9

Sequence 1:NP_725192.2 Gene:Galphaq / 36384 FlyBaseID:FBgn0004435 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001178765.1 Gene:Gnal / 24611 RGDID:2715 Length:450 Species:Rattus norvegicus


Alignment Length:410 Identity:152/410 - (37%)
Similarity:230/410 - (56%) Gaps:66/410 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EEAKEQKRINQEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGYIK 71
            |.|||.:::::.|::.||..|||.::..:|||||.|||||||.:|||||:|.:|::.|:|:..|.
  Rat    85 EAAKEARKVSRGIDRMLREQKRDLQQTHRLLLLGAGESGKSTIVKQMRILHVNGFNPEEKKQKIL 149

  Fly    72 LVFQNIFMAMQSMIKAMDML--KISYGQGEHSELADLVMSIDYETVTTFE--DPYLNAIKTLWDD 132
            .:.:|:..|:.:::.||..:  .:.....|:...:|.:.||  ..:|.||  ..:.:.:|.||||
  Rat   150 DIRKNVKDAIVTIVSAMSTIIPPVPLANPENQFRSDYIKSI--APITDFEYSQEFFDHVKKLWDD 212

  Fly   133 AGIQECYDRRREYQLTDSAKYYLKDLDRVAQPAYLPTEQDILRVRVPTTGIIEYPFDLEEIRFSY 197
            .|::.|::|..||||.|.|:|:|:.:|.|:                                   
  Rat   213 EGVKACFERSNEYQLIDCAQYFLERIDSVS----------------------------------- 242

  Fly   198 LSDLARIEQADYLPTEQDILRARVPTTGILEYPFDLDGIVFRMVDVGGQRSERRKWIHCFENVTS 262
                    ..||.||:||:||.||.|:||.|..|.:|.:.|.|.||||||.||||||.||.:||:
  Rat   243 --------LVDYTPTDQDLLRCRVLTSGIFETRFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTA 299

  Fly   263 IIFLVALSEYDQILFESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIM--YSHL 325
            ||::.|.|.|:.::.|.:|.||:.||..||.:|....|.:..|:||||||:|:|.||::  .|.:
  Rat   300 IIYVAACSSYNMVIREDNNTNRLRESLDLFESIWNNRWLRTISIILFLNKQDMLAEKVLAGKSKI 364

  Fly   326 VDYFPEY-----------DGPQRDAITAREFILR-MFVDLNP---DSEKIIYSHFTCATDTENIK 375
            .||||||           |..:...:|..:|.:| :|:.::.   |.:...|.|||||.|||||:
  Rat   365 EDYFPEYANYTVPEDATPDAGEDPKVTRAKFFIRDLFLRISTATGDGKHYCYPHFTCAVDTENIR 429

  Fly   376 LVFCAVKDTIMQNALKEFNL 395
            .||...:|.|.:..||::.|
  Rat   430 RVFNDCRDIIQRMHLKQYEL 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaqNP_725192.2 G-alpha 34..390 CDD:206639 139/376 (37%)
GnalNP_001178765.1 G_alpha 93..447 CDD:214595 147/398 (37%)
G-alpha 112..444 CDD:206639 139/376 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.