DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaq and gpa-9

DIOPT Version :9

Sequence 1:NP_725192.2 Gene:Galphaq / 36384 FlyBaseID:FBgn0004435 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001256444.1 Gene:gpa-9 / 191659 WormBaseID:WBGene00001671 Length:96 Species:Caenorhabditis elegans


Alignment Length:93 Identity:39/93 - (41%)
Similarity:60/93 - (64%) Gaps:3/93 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   300 WFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGP-QRDAITAREFILRMFVDLNPDSEKIIYS 363
            :|.::::||||||.||.|.||.::::...||:|:|| :||.  |.|:|...|:.||.:..:.||.
 Worm     2 YFHSTAIILFLNKIDLFEIKITHTNITVAFPDYEGPRERDC--ALEYIRVQFISLNNNKNRKIYQ 64

  Fly   364 HFTCATDTENIKLVFCAVKDTIMQNALK 391
            |.|.||||..|::|...:.|.|:..:||
 Worm    65 HVTSATDTARIQVVIDMLFDIIISASLK 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaqNP_725192.2 G-alpha 34..390 CDD:206639 37/90 (41%)
gpa-9NP_001256444.1 P-loop_NTPase <2..91 CDD:304359 37/90 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.