DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaq and gpa-18

DIOPT Version :9

Sequence 1:NP_725192.2 Gene:Galphaq / 36384 FlyBaseID:FBgn0004435 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001293719.1 Gene:gpa-18 / 189161 WormBaseID:WBGene00020997 Length:320 Species:Caenorhabditis elegans


Alignment Length:298 Identity:61/298 - (20%)
Similarity:113/298 - (37%) Gaps:68/298 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RRELKLLLLGTGESGKSTFIKQMRIIHGSG---------YSDEDKRGYIKLVFQNIFMAMQSMIK 86
            |..::.|:||...:||::||:||...|...         |.       ::|...||:..::::|:
 Worm     9 RGPIRTLVLGCMGAGKTSFIRQMVKNHTKSICLRRELYLYC-------VQLNLLNIYRELKNVIE 66

  Fly    87 AMDMLKISYGQGEHSELADLVMSIDYETVTTFEDPYLNAIKTLWDDAGIQECYDRRREYQLTDSA 151
            |:: :.||..|.:.....|     :|.....|....:.|:|.|::....:.|..|:|...|..:.
 Worm    67 ALE-IPISEDQKQRFTQLD-----EYRHREVFPPKIIEAMKELFESGLYELCRLRQRILPLPQNY 125

  Fly   152 KYYLKDLDRVAQPAYLPTEQDILRVRVPTTGIIEYPFDLEEIRFSYLSDLARIEQADYLPTEQDI 216
            .:..:..|....|.|:|:|.                    ||..||..                 
 Worm   126 HFLFQRGDDFMNPEYVPSEL--------------------EIMMSYSQ----------------- 153

  Fly   217 LRARVPTTGILEYPFDLDGIVFRMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFESDN 281
                  |.|:........|..|.::::.|....|.||...|::...::|::.|||.....|.  |
 Worm   154 ------TCGLNRENVTCQGYKFELLEMPGHHLWRAKWADYFDDPNLVVFVIDLSELCDPAFY--N 210

  Fly   282 ENRME-ESKALFRTIITYPWFQNSSVILFLNKKDLLEE 318
            :..:| ::..:|.:::..|.......:|..||.|...:
 Worm   211 KGYLENKTVTVFESLVNNPVLAKVYWLLLFNKADTFND 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaqNP_725192.2 G-alpha 34..390 CDD:206639 60/295 (20%)
gpa-18NP_001293719.1 G-alpha 12..309 CDD:278904 60/295 (20%)
P-loop_NTPase 12..289 CDD:304359 60/295 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.