DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaq and gsa-1

DIOPT Version :9

Sequence 1:NP_725192.2 Gene:Galphaq / 36384 FlyBaseID:FBgn0004435 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001367988.1 Gene:gsa-1 / 171687 WormBaseID:WBGene00001745 Length:378 Species:Caenorhabditis elegans


Alignment Length:407 Identity:159/407 - (39%)
Similarity:229/407 - (56%) Gaps:62/407 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EAKEQKRINQEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGYIKL 72
            |.:|.:::|::||:||.:||:..|...:|||||.|||||||.:|||||:|.:|:::.:||..|..
 Worm    14 EGREARKVNKQIEEQLAKDKQVMRATHRLLLLGAGESGKSTIVKQMRILHINGFNEAEKREKITD 78

  Fly    73 VFQNIFMAMQSMIKAMDML--KISYGQGEHSELADLVMSIDYETVTTFEDPYLNAIKTLWDDAGI 135
            :.:|:..|||.:::|||.:  |:|......:...|.::.|..:....:...:.:.|.|.|.|.|:
 Worm    79 IRRNVRDAMQVILRAMDEIVPKVSLDDPSTAISRDYILRITNDPEDNYPSEFYDHILTCWKDKGV 143

  Fly   136 QECYDRRREYQLTDSAKYYLKDLDRVAQPAYLPTEQDILRVRVPTTGIIEYPFDLEEIRFSYLSD 200
            ..||:|..||||.|.|:|:   ||:|          |::|                         
 Worm   144 MACYERSSEYQLIDCAQYF---LDKV----------DVVR------------------------- 170

  Fly   201 LARIEQADYLPTEQDILRARVPTTGILEYPFDLDGIVFRMVDVGGQRSERRKWIHCFENVTSIIF 265
                 |.:|.|:||||||.||.||||.|..|::|.:.|.|.||||||.||||||.||.:||:|||
 Worm   171 -----QNNYDPSEQDILRCRVMTTGIFETKFEVDKVRFHMFDVGGQRDERRKWIQCFNDVTAIIF 230

  Fly   266 LVALSEYDQILFESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSH--LVDY 328
            :.|.|.|:.:|:|.:.:||:.||.|||:.|....|.:..||||||||:|||.|||....  |..:
 Worm   231 VCASSSYNLVLWEDNTQNRLRESLALFKNIWNNRWLKTISVILFLNKQDLLSEKIKAKRYLLESF 295

  Fly   329 FPEYDG------------PQRDAITAREFILRMFVDL---NPDSEKIIYSHFTCATDTENIKLVF 378
            |||::|            ..:|.:.|:.||...|:.:   |.|.....|.|||||.|||||:.||
 Worm   296 FPEFEGYNLPNDAVFDNQEDKDVVRAKYFIRGEFLRISTANSDGRHHCYPHFTCAVDTENIRRVF 360

  Fly   379 CAVKDTIMQNALKEFNL 395
            ...:|.|.:..|:::.|
 Worm   361 NDCRDIIQRIHLRQYEL 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaqNP_725192.2 G-alpha 34..390 CDD:206639 147/374 (39%)
gsa-1NP_001367988.1 G-alpha 40..372 CDD:206639 147/374 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.