DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaq and gnat2

DIOPT Version :9

Sequence 1:NP_725192.2 Gene:Galphaq / 36384 FlyBaseID:FBgn0004435 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_571944.1 Gene:gnat2 / 140429 ZFINID:ZDB-GENE-011128-10 Length:354 Species:Danio rerio


Alignment Length:398 Identity:179/398 - (44%)
Similarity:235/398 - (59%) Gaps:58/398 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SEEAKEQKRINQEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGYI 70
            |.|.||..:.::|:||||:.|.....:.:||||||.|||||||.:|||:|:|..||:.|::..:.
Zfish     6 SAEDKEMAKKSKELEKQLQEDADKEAKTVKLLLLGAGESGKSTIVKQMKILHQGGYTKEEQMEFR 70

  Fly    71 KLVFQNIFMAMQSMIKAMDMLKISYG----QGEHSELADLVMSIDYETVTTFEDPYL-NAIKTLW 130
            .::|.||..:..::|:.|:||.|::|    |.:..:|.:|..||:..|:    .|.| :.||.||
Zfish    71 SIIFGNILQSALAIIRGMEMLSINFGSPSAQEDSQKLQNLSDSIEEGTM----PPELADVIKRLW 131

  Fly   131 DDAGIQECYDRRREYQLTDSAKYYLKDLDRVAQPAYLPTEQDILRVRVPTTGIIEYPFDLEEIRF 195
            .|||:|..:||..||||.|||.|||.::||:.:|.|||||||:||.||.||||||..|..:|:. 
Zfish   132 KDAGVQASFDRAAEYQLNDSAGYYLNEMDRICKPDYLPTEQDVLRSRVKTTGIIEEQFGCKELH- 195

  Fly   196 SYLSDLARIEQADYLPTEQDILRARVPTTGILEYPFDLDGIVFRMVDVGGQRSERRKWIHCFENV 260
                                                      |||.|||||||||:|||||||.|
Zfish   196 ------------------------------------------FRMFDVGGQRSERKKWIHCFEGV 218

  Fly   261 TSIIFLVALSEYDQILFESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHL 325
            |.|||..|||.||.:|.|.|..|||.||..||.:|..:.:|..:|::||||||||.:|||...||
Zfish   219 TCIIFCGALSAYDMVLVEDDEVNRMHESLHLFNSICNHRFFATTSIVLFLNKKDLFQEKIKKVHL 283

  Fly   326 VDYFPEYDGPQ--RDAITAREFILRMFVDLN-PDSEKIIYSHFTCATDTENIKLVFCAVKDTIMQ 387
            ...||:||||.  .|   |..:|...|.||| ....|.||||.||||||:|:::||.||.|.|::
Zfish   284 SICFPDYDGPNTYED---ASNYIKTQFQDLNMKKGVKEIYSHMTCATDTKNVEIVFNAVTDIIIK 345

  Fly   388 NALKEFNL 395
            ..||:..|
Zfish   346 ENLKDCGL 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaqNP_725192.2 G-alpha 34..390 CDD:206639 166/363 (46%)
gnat2NP_571944.1 G_alpha 13..352 CDD:214595 174/388 (45%)
G-alpha 34..348 CDD:206639 166/363 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R507
SonicParanoid 1 1.000 - - X53
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.